KEGG   Chenopodium quinoa (quinoa): 110707684Help
Entry
110707684         CDS       T05764                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi00051  Fructose and mannose metabolism
cqi00052  Galactose metabolism
cqi00500  Starch and sucrose metabolism
cqi00520  Amino sugar and nucleotide sugar metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01200  Carbon metabolism
Module
cqi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cqi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110707684
   00051 Fructose and mannose metabolism
    110707684
   00052 Galactose metabolism
    110707684
   00500 Starch and sucrose metabolism
    110707684
   00520 Amino sugar and nucleotide sugar metabolism
    110707684
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110707684
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqi04131]
    110707684
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110707684
Membrane trafficking [BR:cqi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110707684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 HMG-CoA_red
Motif
Other DBs
NCBI-GeneID: 110707684
NCBI-ProteinID: XP_021741405
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MRKAAVGVAVIGAAAVCVAAAVVVRQRMKSSRKWGRVMAILKELDDKCGTPLGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEHR
VVQQEFDEVSIPPELMVGTSEQLFDYIAEALAKFVATEGEGLHPEPNKQRELGFTFSFPV
KQTSIASGTLIRWTKGFKIEDAVGEDVVAELTKAMQRKGVDMRVTALVNDTVGTLAGGRY
HKEDVIAAVILGTGTNAAYVERASAIPKWHGSLPKSGEMVINMEWGNFRSSHLPLTEYDI
ALDEESLNPGEQIYEKLISGMYLGEIVRRVLYRMADEAGLFGDTVPPKLNTPFILRTPDM
SAMHHDTSPDLKVVASKLKDVLGIPSSSLKVRKIVVDVCDVIASRGACLSAAGILGIIKK
LGRDTLKQGENQKSVVALDGGLFEHYAKFRECMEDSLKELLGDEVAETIVIEHSNDGSGI
GAALLAASHSQYLEEE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagcagcggtgggggtggcggtgataggtgcggcggcggtgtgtgtggcggcg
gcggtggtggttcgacaaaggatgaagagttcaagaaagtggggtcgtgtaatggctata
cttaaggagcttgatgacaagtgtgggacccctttgggtaagcttagacaggttgctgat
gctatgactgttgagatgcatgctggtcttgcatctgaaggtggttctaagcttaagatg
ctcatcagctatgttgataatcttcctactggggacgagcatggattgttttatgcatta
gatcttggtggcaccaacttccgagtgcttcgagtgaagttgggtggcaaagaacatcgt
gttgtccaacaagaatttgacgaagtatcaattccgcctgagttgatggttgggacatca
gaacaactgtttgactacatagctgaggcccttgctaaatttgttgcaacggaaggtgaa
ggcctacatcctgaacccaataagcagagagagttgggatttaccttctctttcccagta
aagcagacatcgattgcatcagggacccttataagatggaccaagggttttaaaatagaa
gatgcggttggtgaagatgtggtggcagaattaaccaaggccatgcaaagaaagggtgta
gatatgcgtgtgacagctttggtcaatgatacagttggaaccttagctggaggtagatac
cataaagaagatgtaattgctgctgttatattgggtactggaacaaatgcagcttatgtt
gaacgtgctagtgcaattcccaagtggcatggctctttgcccaaatcaggggagatggtt
attaacatggagtggggcaatttccgttcatcacatttacctttgaccgaatatgacata
gcactagatgaagaaagtttgaatcctggtgaacagatatatgagaaattgatttctgga
atgtacttgggtgagattgtgcgaagagtcttgtataggatggcggatgaggccggcctt
tttggtgatacagtcccaccaaaattgaatactccattcatcttaaggacaccagacatg
tctgccatgcatcatgatacatcccctgatcttaaagttgttgcaagcaaactgaaggac
gtcctagggataccaagttcatcattgaaggtgagaaagattgtagttgatgtttgtgac
gtcattgcttctcgcggggcctgcctttctgcagctgggattttgggcattattaagaaa
ctagggagagacacattgaagcaaggtgaaaatcagaagtctgttgttgcattagacgga
gggttgtttgagcactacgccaaattccgggagtgcatggaagactctttgaaggagctg
ctaggtgatgaagtcgctgaaaccattgtaattgagcactcaaatgatggatcaggcatt
ggggctgcccttctggcagcgtcccattcccaataccttgaggaggaataa

DBGET integrated database retrieval system