KEGG   Chenopodium quinoa (quinoa): 110709281Help
Entry
110709281         CDS       T05764                                 

Definition
(RefSeq) uncharacterized protein LOC110709281
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 110709281
NCBI-ProteinID: XP_021743190
LinkDB All DBs
Position
Unknown
AA seq 149 aa AA seqDB search
MRNVATCRLDDAVQEGQPIPSRTRTRFEVRREPVRSSSRRRRTGSGGRGGRSEAAGTEAI
EGSGTSSKGAYAAPVGQGEATSALKGGGMYEVGSSSQQPPQPQPQVDFGRTGLVLSFPPP
KETGAGASGEVTPRTAHFYEMMGVRPPTP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatgtggctacatgtcgtcttgacgacgccgtccaggagggtcagcccattcct
tctcgtacccgcacgagatttgaggtgcggagggagccggtgaggtctagctcgagacgt
cgccgcactggttctggtggtcgaggcggtcgttctgaggctgccggtaccgaggcgata
gagggctcagggacttcatctaagggtgcatatgctgcgccggtgggccagggagaggct
acctcggctcttaaaggtggtgggatgtacgaggtcggctcgtcatcgcagcagcctccg
cagcctcagcctcaggttgattttgggaggacgggtcttgtgctgagttttccacctccc
aaggagaccggagctggagctagtggagaggttactcctcgtacggcgcatttttatgag
atgatgggtgtacgtcccccgacgccgtag

DBGET integrated database retrieval system