KEGG   Chenopodium quinoa (quinoa): 110710556Help
Entry
110710556         CDS       T05764                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00040  Pentose and glucuronate interconversions
cqi00051  Fructose and mannose metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110710556
   00051 Fructose and mannose metabolism
    110710556
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110710556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Sacchrp_dh_NADP Pyr_redox_2 2-Hacid_dh_C NCD3G FAD_binding_2 TrkA_N Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 110710556
NCBI-ProteinID: XP_021744574
LinkDB All DBs
Position
Unknown
AA seq 362 aa AA seqDB search
MGKGGNANDVSGSSENMAAWLLGVNNLKIQPFKLPNLGPNDVRVRMKAVGICGSDVHYLK
TMSCGDYQVKEPMVIGHECAGIIEEVGSEVTDLAPGDRVALEPGIGCWRCNRCKEGSYNL
CPDMKFFATPPIHGSLANQIVHPATLCFKLPDNVSLEEGAMCEPLSVGVYGCRRTKVGAE
TTVLIIGAGPIGLVTLLSAKAFGAPRIVVADVDEHRLSVAKSLGAYDVVQVSTNKEDVAV
EVEKIKKAMGKDVDVTLDCAGFDKTVSTALGATRNGGKVCLIGMGHCIMTVPLTPAASRE
VDVLGVFRYKNTWPQCLEFLSSGKIDVKPLITHRFGFTEEEVVEAFETSARGGNAIKVMF
NL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggtggaaacgctaatgatgtttctggttcttctgaaaacatggcagcatgg
cttcttggagttaataatctcaagattcaacctttcaaacttcctaatcttgggcctaat
gatgtaagggttcggatgaaggcagttggaatttgtggtagtgatgttcactacttgaag
acaatgagttgtggagattaccaagtcaaagaaccgatggtaatcggccatgaatgtgct
ggtatcattgaagaagtcggtagcgaggtgactgacctagctcccggtgatcgggtagca
ctcgagccggggatcggctgttggaggtgtaatcgctgcaaggaaggaagctacaatctt
tgccctgatatgaagttttttgcaactcctcctattcatggttctcttgcaaatcagatt
gtgcaccctgcaactttatgctttaaactacctgataatgtaagtttggaagaaggagca
atgtgtgagcctctaagtgttggtgtttacggttgtcgtcgcactaaggttggggctgag
actacagttttgatcattggagcaggacctattggtcttgttactctgctttcagccaag
gcttttggagcccctaggattgtggtggctgatgttgatgaacatcgtctctctgttgct
aagagtcttggtgcttatgatgttgtccaagtttctactaacaaggaggatgtggccgta
gaagttgagaaaattaagaaagctatgggaaaagacgtagatgttacccttgattgtgcc
ggttttgataaaaccgtatcaactgctttgggtgctactcgaaacggaggcaaagtttgc
ctaattgggatgggtcattgtatcatgaccgttcctttaaccccggctgcctcaagggag
gtagatgtgttaggagtttttcggtacaagaacacttggccacaatgtttagagtttttg
agtagcggaaaaattgatgtgaagcctctaataactcataggtttggattcaccgaagag
gaggtggtggaagcatttgagaccagtgctcgtggtggtaatgcaatcaaagtcatgttc
aatctttaa

DBGET integrated database retrieval system