KEGG   Chenopodium quinoa (quinoa): 110712030Help
Entry
110712030         CDS       T05764                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ATXR3-like
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00310  Lysine degradation
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110712030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET GYF_2 GYF F-box-like
Motif
Other DBs
NCBI-GeneID: 110712030
NCBI-ProteinID: XP_021746148
LinkDB All DBs
Position
Unknown
AA seq 2388 aa AA seqDB search
MGDGGVACVPLQPIMEKFPGSETFCGSGSGGSNNNSNGKLETKPVKRTTTKRMKLKRDAF
FKKDEPGKTEPVPEKVKSSGEVENGEIGGDKVQKDEIEEGELGTLKSPRRDGENGEFMPD
MLHKTETEKGEIVTDKWRRDEYEKGEFSPPRWRKGDAERYDFSSGRFRNDSVQRRDRTPE
KYRKGEYEKGEFSSWRGSKDEVEKGEFIPERWHKGDVFRDDYGYLKGRRHDSSRDRERRY
EHDWTPSSVRYSGEDVSPSRDFSRSGNHRHVKRNPRWEVSQERSYPKLSSKMMDDVAYKN
EYSHGRGHGREHSSGGRLKRHGTDSESSDRKPYDDHGDYVSMKSRRLSNPEHYSRQSADK
SFRHSNSSRPVSDRLSLRHYDAAPTRAAYDRQRRSPSYSERSPHERGRHHDHRDRTPARH
ERSPCYRGHRHDNRNRSPSYIEKSPNDRVRVHDRRERSSSYSGSPPERSRPFNHRQTSRS
EVSETKLSDRVQSEKPTEKIHKDKDSTISVKDPLNVNDKPNGTVDQGISYESHVKDENQG
PCLDVKEQPSLVNGNIEELPSMEEDMDICDTPPHVPCVASVNPGKWYYLDHYGEERGPSR
LCDLKALIEGGILVSDHLVKHSDSDRWVTVENAASPVVTPNFTTIFSETVTQLVSPPEAP
GNVLADVGDAEHSVDQVGMESLDSSIHCGTGQSDLLPLDDLGIDERVGALLDGVTVLPGK
ELEIVGEVLQMTFDHSEWEKFGILEGFMQDYSCSQDPLEQNQEEDISRHPDSTSKDTAES
TSTASLDKECSYLLSEFTEWFSGRWSCKGGDWQRSEDAIQDKYFRKKVVLNDGFPLCQMP
KSGYEDPRWQRKDDLYYPCQSRKLDLPSWAFSWPDERSDSSAINKSVQAKPAAVRGVKGS
MMPVIRINACVVKDHGSFVSDSRLKPRGKDKYSSKGIKHYSLSTDVKQSPEEEAFHFKSS
KEQSSGGSWESSIVNKPKDRVCTANDLQLHLGDWYYLDGTGHEHGPFSCSVLLKLVNEGF
LKKRSSVFRKLDKVWVPVISVIKASENMNQLVGDSIVPVGVSSVAPAVHGDSCSLSNSFH
SLHPHFIGYTLGKLHELVMKSYKSREFAAAINEVLDPWINIRQPRKETEKHRSSLYLQKS
PMENEVSMLFEEDMHGKKRCRTLIDGDDENYEVAKGLSRFSYREPSFEDLCGSVTFCKEE
GVCSKNEVGSWGLLDGHILARIFHFLRTDIKSLMFAGTTCKHWRAAVGFYKNVSVRVDLS
TMGSNCSDSIIGSVMSGYNKQMIKVLVLDGCTNVTSAVLEEILQSFSCISSVDIRGCSQF
EELIFKYPHVNWVREWSSQGIGFEESYSKIRSLKQMPEQSSSVSKLGHGSYMDESSGLKD
YFDMVEKRGAANQAFRQNLYKRTKLLDARKSASVLARDARMKHLAMKKAGNGYRKMEEFL
VLSLKDIMKGNTSDYFVEKVAEIQNKIQNGYYANRGLSSAKQDITKMCKDAIKLQKRGEA
GDMESVIHLFIKLGTRLDESFKSAINRDEMMKKLRDETSGPSGHRKSKTPTERKYTSRAN
GSSSVNGDFDYLECSSDREIRKNLSRTYKKADMDGESSDEFVSSSDDGSNTGSASDTESD
SDVRSGVTFESKEEYFNEDDAFDLTPEDREWGARMTKASLVPPVTRKYEVIEQYVIVADE
AEVQRKMKVSLPENYEDKVKAQKNGSELVDMEIPEVKQYKPRKELGQEVIEQEVYGIDPY
THNLLLDSMSENVDWSLTEKHVFIEDVILRVLNKQVRQYTGSGNTPMTYPLRPVIVEILG
TAKQDNNTSTLKLCEALLQAIDGRPDDNYVAYRKGLGVVCDKQGGFTKDDFVVEFLGEVY
PAWKWFEKQDGIRSLQKNSKEPAPEFYNIYLERPKGDADGYDILVVDAMHKANYASRICH
SCRPNCEAKVTAVSGQYQIGVYSVRPIGFEEEITFDYNSVTESKEEYEASVCLCGNQVCR
GSYLNLTGEGAYQKVLKEWHGLLDKHRLLLEACELNWVSEEDYIDLGRAGLGSCLLGGLP
DWLVAYSARLVRFINFERTKLPAEILRHNLEEKKKYCQEISLEMEKSDAEVQAEGVYNQR
LQNLALTLDKVRYVLRCVFGNPKEAPPPLQKLSPEEMVSVLWSGEGSLVNQLLECIAPHI
IDDRILLDLKSNIRAHTPSSSGNLEKDLRKSLLWLRDEVRNLPCTYKSRHDAAADLIHIY
AYTKCFYKIREYKSVTSSPVSISPLDLGPKCATKLSGVVEYCKTYGENYCLGQLIYWHNQ
ANTDPDRVLVRASRGCLSLPDIGSFYAKAQKPSRQRIYGPRTVRFMLRRMEKQPQKPWPL
DRIWSFESSSKFFGSPMLDAVLNNSPLEREMVIWLKNRPAIFQAMWDR
NT seq 7167 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatggaggtgttgcatgcgtgcctttgcagccaattatggagaagtttccgggt
tccgaaacattttgcggcagcggcagtggcggtagcaacaacaatagtaatggaaaattg
gagactaaaccagttaagaggactactactaagaggatgaagttgaagagagatgcgttt
ttcaagaaggatgagccggggaagaccgagccggttccggagaaagtgaagagcagtggg
gaagtagagaatggggaaattgggggtgataaagtgcagaaagacgagattgaagaagga
gaattggggacattgaaatcgccccggagagacggggagaatggcgaatttatgcctgat
atgttgcacaagactgagactgaaaaaggtgagattgttactgacaagtggaggagggat
gaatatgagaaaggggagttttctccgcccaggtggcgaaaaggggatgcggagaggtat
gatttcagctcagggagattccggaatgactctgttcagagacgggatcgaactccggag
aagtataggaaaggagaatacgagaagggggaattcagttcgtggagagggtccaaagat
gaagtcgagaagggagaatttattcctgagaggtggcataaaggagatgtttttagggac
gattatggctacttgaaagggcgcaggcatgattcaagtagagatcgagaacgaagatat
gaacatgactggaccccgtcttctgtacgatattcaggtgaggatgtctctcccagcagg
gatttcagtagaagtgggaatcatcgccatgtcaagagaaatccgaggtgggaagttagc
caagaaaggagctacccgaaattgagctcaaaaatgatggatgatgtggcttataagaat
gagtacagtcatgggagaggccatggaagagaacactcatcaggtggtcgattgaagagg
catggcactgactcggaaagcagtgaccgcaagccctatgatgatcatggtgattatgtc
agtatgaaaagcagaaggttatcaaatccagagcattactcgcgtcagtctgctgataag
tcatttagacattcaaattcatcaaggcctgtttctgataggctttcattgcgccattat
gatgctgcacctacaagagcggcttatgacaggcagaggcgtagccctagttattctgag
aggtctccacatgagagaggccgacatcatgatcatagggacaggactcctgcgcgtcat
gaaagatccccatgctatcgtggtcatcgccatgacaatagaaatcgaagccccagttat
attgaaaagtctcccaatgaccgcgttagggtacatgatcgccgggaaaggtcttcaagt
tactctggatccccacctgaacgcagtaggccgtttaaccaccgccaaacaagcaggagt
gaagtgagtgagactaagctgagtgatagggtacagagtgaaaagcctactgagaaaatt
cataaggataaagattcaactatctcggttaaagatcctttaaatgtgaatgataagcca
aatggaacagttgaccaaggtatttcctatgagtctcatgtgaaagatgaaaatcaaggt
ccttgtttggatgtcaaggaacaaccttcattggtcaatgggaatattgaagaattgcca
tcaatggaagaagatatggatatatgtgacacacctccacatgtcccttgtgtggctagt
gtgaacccagggaaatggtattaccttgatcactatggagaggagcgcggtccttctaga
ttatgcgacttaaaagcacttatagaaggaggaatacttgtgtcagatcacctggttaag
cactctgacagtgacaggtgggtgactgttgaaaatgcagcttctccagtcgtaactcct
aattttacaacaattttttctgagacggtcacacagctggtgagccctcccgaggctcct
ggaaatgtgctggctgatgttggagatgctgagcattctgtggatcaggttggtatggag
agtttagattcttctattcattgtgggactggtcaatctgaccttcttcctcttgatgat
cttggcatcgatgaaagagttggggctcttttagatggcgttactgttttacccggaaag
gaactcgagatagttggagaagtactacagatgacatttgatcattcagaatgggaaaaa
tttggtatcttggaaggctttatgcaagattattcatgcagtcaggaccctttggagcag
aatcaagaagaggatatatcaagacatccggactctacatcaaaggacactgctgaatcc
acctctactgctagccttgataaggaatgctcttacctcttgagtgaatttactgaatgg
ttctctggtcgatggtcatgtaaaggcggggactggcaaagaagtgaagatgccattcaa
gacaaatattttaggaaaaaggttgtgttgaatgatggtttccctctttgtcagatgcca
aaatctggttatgaggacccacgatggcagagaaaagatgacttgtactacccttgtcaa
agcaggaagcttgatcttccctcctgggcattttcctggcctgatgagaggagtgattct
agtgcaatcaacaagtccgttcaagcaaaacctgctgctgtaagaggggtaaaaggaagt
atgatgccggtgattagaatcaatgcatgtgttgttaaagatcatggttcatttgtttct
gactctcggttgaaaccaagggggaaggacaagtactcttcaaagggaattaagcattac
tctttatccactgatgttaagcaatctcctgaagaagaagcttttcatttcaaaagctct
aaggagcaaagttctggaggatcgtgggaatctagtattgtcaataaaccgaaagaccga
gtttgcactgcaaatgacttacagttgcacttaggtgactggtattaccttgatggcacc
gggcatgaacatggaccattttcatgctcagtactgcttaagttggtgaatgaaggtttt
ttgaagaagcgaagcagtgtgtttcgtaaacttgacaaagtttgggttccagttatttct
gtaatcaaggcctcagaaaatatgaaccaactcgttggagatagtattgttcctgttggt
gtatcttctgtagcacctgctgtgcatggtgatagctgttcactttctaattcattccat
agcttgcatccccactttattggttatacactagggaagcttcatgaattagtcatgaaa
tcttataagagtcgtgagtttgctgctgctatcaatgaggtcttagatccatggattaat
attagacagccaaggaaggaaacagagaagcatagaagttctctttatcttcaaaaatct
cccatggagaatgaagtatctatgctttttgaggaagacatgcatggtaaaaaaagatgc
cggacacttattgatggagatgatgaaaattatgaagtggccaaaggcttatcacgtttc
tcttatagggagccctcatttgaggacttatgtggcagtgttactttttgcaaagaagag
ggtgtgtgttctaagaatgaggtggggagctggggtctactggacggtcatattttggca
cgcatttttcattttcttagaactgatatcaaatccctaatgtttgctggcacaacttgc
aagcactggagagctgctgttggtttctacaaaaatgtgagtgtaagggtcgatttgtca
actatgggctccaactgcagtgactccattattgggagtgtcatgagtggatataataag
caaatgatcaaggtgttagttttagatggttgtaccaatgttacttcagctgtgcttgag
gagattcttcagtcattttcttgtatatcctctgttgatataagaggttgcagccagttt
gaggagttaatattcaaatacccccatgtaaactgggttagagagtggagttcacaaggc
attggttttgaagagtcatattcaaagataaggagtttaaaacagatgcccgaacaatct
tcatcagtttctaaattgggtcatgggagttatatggatgagtccagtgggctaaaagat
tactttgatatggtggaaaaaagaggtgcagctaatcaggcattcaggcagaatctatat
aagcgtacaaaactgcttgatgctcggaaatctgcatctgtcctagcccgtgatgcccgt
atgaagcatttggctatgaagaaggctggaaatgggtacagaaaaatggaggaattcctt
gtgcttagcttaaaggatattatgaaggggaacacatctgactattttgtggagaaggtt
gcagaaattcagaacaaaattcagaatggatattatgctaatcgcggcttgagctctgct
aaacaagatatcactaaaatgtgcaaggatgcaataaaattacaaaaacgaggtgaagca
ggtgatatggagagtgttatacatctgtttattaaacttggaacacgtcttgatgaaagc
tttaaatcagctattaatagagatgagatgatgaaaaaactgagggatgaaaccagtggt
ccctctggtcacagaaagtctaaaacacccacagagagaaaatatacaagcagggccaat
ggctcatcatcagtcaatggggattttgattatttggagtgttcttctgaccgggagatt
agaaagaatctttcaagaacgtataagaaagcagacatggatggtgaatcatctgatgag
tttgtgtcatcttcagatgatggaagtaatactggaagtgcctcggacacagagagtgat
tcagatgtacgttcaggtgttacttttgagtcaaaagaggaatatttcaatgaagatgat
gcttttgatttaacccctgaggatcgtgaatggggtgctcgtatgaccaaggccagtctt
gtgcctccagtgactcggaaatatgaagttattgaacaatatgttattgtagctgatgag
gctgaagtgcaacgaaagatgaaggtttcattgcctgaaaattacgaggataaagtgaaa
gctcagaaaaatggttctgaattggtggatatggaaattcctgaagttaaacaatataaa
ccacggaaagagcttggacaggaggttatagaacaggaggtgtatggaattgatccttat
acacacaatcttcttcttgattcaatgtctgaaaatgtggattggtctcttacagaaaag
catgtttttattgaagatgtgatccttcgggtattgaataaacaagttagacaatacaca
ggcagtggaaatacacccatgacttatcctttgagacctgtcatagtggaaattcttgga
acagctaagcaagataataatacgagcactctgaaactttgtgaggctcttttacaagcc
attgatggacggcctgacgacaattatgttgcttatagaaaggggcttggtgtagtctgc
gacaaacaaggtggtttcactaaagacgattttgttgttgaatttttgggagaggtttac
cctgcttggaagtggtttgagaaacaggatggaatccgttctctgcagaagaatagtaaa
gaacctgcacctgaattctacaacatatatctcgagaggcccaagggtgatgctgatggc
tatgatatactcgttgttgatgctatgcataaggcaaattatgcaagtcgaatttgtcat
tcgtgtcgacctaattgtgaggcaaaagttacagctgtaagtggtcagtatcaaattgga
gtctactctgttcgcccaattggatttgaggaggaaattacctttgactataattcagtt
actgagagtaaggaagaatatgaagcctctgtttgtttgtgtggtaatcaagtctgccgt
ggaagctatttgaatttaacaggcgaaggggcttatcagaaggtgctgaaggagtggcat
ggactattggataagcaccgtttgctcctggaggcatgcgaattgaattgggtatctgag
gaggattatattgatttaggaagggctggtctcggaagttgtttgttgggcggtttgcct
gattggctggttgcttattcagctcggctggtacgtttcataaattttgaaagaacaaag
cttcctgcagaaatcttgaggcataatttggaagaaaagaagaagtattgtcaagaaata
tctctagagatggagaagagtgatgctgaagtccaggcggaaggagtttacaaccagaga
ctccaaaatttggctctgacattggataaggttaggtatgtcctaagatgtgtatttgga
aacccaaaggaagctcctcctcctttgcagaagcttagtcctgaagagatggtgtctgtc
ttgtggagtggagaaggttcacttgttaatcaacttcttgagtgcatcgctccacatata
attgatgatcgcatactactggaccttaaatcaaatatccgtgctcatactccatcaagc
tccgggaatcttgaaaaagacctaaggaaatctttattatggttgagggatgaggttcgc
aatcttccttgtacatataaaagtcgacatgatgcagctgctgatttgatccacatatat
gcttacacaaaatgtttctacaaaattagggaatacaagtctgtaacttcatctcctgtt
tccatcagccctcttgatcttggacctaagtgtgctacaaaactgtctggggtggttgaa
tattgcaagacttacggtgaaaactactgtttaggacagttgatttattggcacaatcag
gctaacactgacccagatcgtgtgttagtacgagcaagcaggggctgcttgtcattgcct
gatattggttctttttatgccaaggctcaaaagccatcaaggcagcgtatttatggtcca
aggactgtaagatttatgcttcgtcgaatggaaaaacagcctcagaagccatggcctttg
gataggatatggtcattcgagagttcctcaaaattttttggtagtcctatgttagatgcc
gtattgaataattctccactggagcgggaaatggtgatttggttgaagaatagacccgcc
atattccaagccatgtgggatcgatga

DBGET integrated database retrieval system