KEGG   Chenopodium quinoa (quinoa): 110717880Help
Entry
110717880         CDS       T05764                                 

Definition
(RefSeq) CLK4-associating serine/arginine rich protein-like
  KO
K13168  splicing factor, arginine/serine-rich 16
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110717880
Spliceosome [BR:cqi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR proteins
    110717880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRY_EERY CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 110717880
NCBI-ProteinID: XP_021752356
LinkDB All DBs
Position
Unknown
AA seq 548 aa AA seqDB search
MWHEARRSEKKVHDMMDAARKRAQRRALFLAKRRGDPQQSIQILGSRCRTYRDDGLYQAT
QDQQGLIPWNGKEDNLIDRFDGRALLDFIRDPETHRFRQLEKTEEEEELAEFVNFERYRD
LIKHRRRGFTDEEGLDHVNQVMEAKFALPFALDRSNPSQTPAVKGTYSQVGFSYDGDGKE
GILSSDDDEDDEEDEDDDDDDEEFNSDDSGDERMEAIAKDFGVKRYGWLVYMDKKAKEEE
KRQKEVIKGDPAIRKLSRKERRKASQLEREKEREAARVTGTRVLHHDPYRESRRSPTYDA
YPRSRRSRSQSRSPSYSRRHGRGHSADHHRSKSKAPKIEFITEFGGSPDRREPKLEGVSP
PPSPPQAEVLNRTSSVRILEALHVDPASGASLEKEKNAKAIKPPVISTSSALAKLKGVTG
APSKQPQGEKKETPQERLKRIMSKQLNKQIKKDAAVVMAKKKEQEKQRLEKLAETSGLSR
SRRRSRSRSYSRSPRRRHRYSRSPSRGRSSRRRRSHSRSRTRSPSRSLSHSRSRSPSRSP
RRRSRSRY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacgaagcgcgtaggtcggagaagaaagtgcacgacatgatggatgctgcaagg
aagagagcgcagcgaagagcgctgtttttggctaagagacgcggtgatcctcagcagtct
atccaaattctcggctctcgttgccgcacttaccgcgatgatggcctttaccaagccact
caggatcaacagggcctgattccttggaatggcaaagaggataatttgattgacagattt
gatgggcgtgctcttcttgattttatccgtgatccggagacccatcgatttcgtcagcta
gagaagactgaggaggaagaagaattagcagagtttgtaaattttgagcgttatcgggat
ttaattaagcatcgacgtagaggatttacagacgaagagggtttggatcatgtcaatcaa
gtaatggaagcaaaatttgcgttgccatttgctcttgacagatcgaatccatctcaaact
cctgcagtcaaaggtacttattctcaggtgggcttctcatatgatggggatggaaaagaa
ggtattctttcttcagatgatgatgaggatgatgaagaagatgaggatgatgatgatgat
gatgaggaatttaacagtgatgatagtggtgatgaacgtatggaagccatagctaaggat
tttggggtgaaaagatatggttggcttgtgtatatggataagaaggcaaaagaggaagaa
aagaggcaaaaagaagtgattaagggagatccagcaattaggaaattgagtcgtaaggag
agaaggaaggcttctcagctagaaagggagaaagaaagggaggctgcacgtgttactgga
acccgtgttcttcatcatgatccttatcgagaatcaaggcggagtcctacatatgatgct
tatcctcgctctagaagatcgagatcacaatcccgttccccatcatattctaggcggcac
ggtcgtggacattcagctgaccatcatcgaagcaagtctaaggcacccaaaatagaattc
atcactgagtttgggggttctcctgacagaagagagcctaagctggaaggagtctctcca
ccaccatctcctcctcaagctgaagtattaaatcgaacttcatcagtccgtatccttgag
gcattacatgttgatcctgcttctggtgcatcacttgagaaagaaaagaatgctaaagcg
ataaagcccccagtaataagcacatcctcggcattagccaaattaaagggagttacaggg
gccccatcaaagcaaccacagggtgaaaagaaggaaacacctcaagagaggcttaaaagg
atcatgagcaagcaactgaataaacaaataaaaaaggatgctgctgtagtgatggctaag
aaaaaagagcaagagaaacagaggcttgaaaagttggcagagactagtggtttgagtcga
agtagacgacgaagccgtagtaggagctacagccgatcccctcggagacgacacagatac
agcagaagtccaagtaggggaaggagttcaaggagacgccgttctcattcccgctctcgt
actcgttctccctcacgttctctatctcattcccgttcacgttctccatcacgctctcca
aggcgcagaagccggtccaggtactga

DBGET integrated database retrieval system