KEGG   Chenopodium quinoa (quinoa): 110719476Help
Entry
110719476         CDS       T05764                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi00020  Citrate cycle (TCA cycle)
cqi00620  Pyruvate metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01200  Carbon metabolism
Module
cqi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110719476
   00020 Citrate cycle (TCA cycle)
    110719476
   00620 Pyruvate metabolism
    110719476
Enzymes [BR:cqi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110719476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 110719476
NCBI-ProteinID: XP_021754124
LinkDB All DBs
Position
Unknown
AA seq 474 aa AA seqDB search
MASLTKLSLSNTNSPAISFSSSLSSTTPLQWRRTTALPPNPRRKPMRVSAKIREIFMPAL
SSTMTEGKIVSWSKSEGDVLRKGESVVVVESDKADMDVETFYDGILAAIVVGEGESAPVG
APIGILAESEEEIEEAKARASQSGSNSEVKAEVPPSPVTAPVETPATTPAVAPTEGGRKG
VATPFAKKLAKQHKVDLKSVSGTGPFGRITPEDVEKAAGIVKPAPAVPSTSAPMPSPAPA
KVSGGNFTEIEGSSVVPFTTMQAAVAKNMMESLSVPTFRVGYPIVTDALDALYAKVKKKG
VTMSALLAKATAMALVQHPALNSTCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKL
DLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGA
SKPTVVADADGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSNIIQNPDSLTM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctctcactaagctatccctctccaataccaattcccctgccatctccttctca
tcttccctctcctccaccacccctctccaatggcgtcgcaccactgcacttccccccaat
cctcgccggaaacccatgagagtctccgccaaaatccgcgagatcttcatgccggcactc
agctcaacgatgacagaagggaagatcgtgtcgtggtcgaaatcggagggtgatgttctt
cgtaagggtgaatcggttgttgttgttgagtccgataaagctgatatggatgtcgagact
ttctatgatgggattcttgccgccattgttgttggtgaaggtgagagtgctcctgttgga
gctccgattgggatattggcggaatctgaggaggaaattgaggaggctaaagctagggct
tcgcaatcaggatcgaattccgaggtgaaagctgaagttcctccttctccggtgactgct
ccggtggaaactccggcgactactccggcggttgcgccgacggagggtgggaggaagggg
gtggcgacgccgtttgcgaagaaattggcgaagcagcataaggtggatttgaaatcggtt
tccgggaccgggccattcgggaggatcacgccggaggatgtggagaaggcggctggaatc
gtgaagccggcgcctgcggtcccttctacatctgctcctatgccttcgccggctcctgcg
aaggttagtggtggaaattttactgaaattgagggatcatctgtagtgccattcactaca
atgcaggcagctgtggccaagaatatgatggagagtctatcagtgcccacttttcgggtt
ggatatccgattgtgaccgatgctcttgacgctctgtatgccaaggttaagaagaagggt
gtgacaatgagtgctttgctagcgaaagctacagcaatggcgcttgttcagcaccctgcg
ctaaattctacatgtaaagatgggaagagctttacttataatagcagtattaacattgct
gttgctgtggcaatcaatggaggattaatcacacctgtgttacaggatgcagacaagttg
gatctttatttgttgtcccaaaaatggaaagaactagtagagaaggctcgttcgaaacaa
ttgcagcctcacgagtataattcaggtactttcaccttgtccaatttgggcatgtttgga
gttgatagatttgacgctatccttcctcctggccagggagctatcatggccgtgggagca
tcaaagcctactgttgttgctgatgctgacggtttcttctcagtaaagaataaaatgctg
gtgaatgtcacagctgatcacagaatcatctatggggctgatttagctgccttcctccag
accttttcaaatatcatccaaaacccagacagtttaacaatgtag

DBGET integrated database retrieval system