KEGG   Chenopodium quinoa (quinoa): 110720583Help
Entry
110720583         CDS       T05764                                 

Definition
(RefSeq) DNA ligase 1-like
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Motif
Pfam: RPN2_C
Motif
Other DBs
NCBI-GeneID: 110720583
NCBI-ProteinID: XP_021755317
LinkDB All DBs
Position
Unknown
AA seq 388 aa AA seqDB search
MARCYPYPPPGYAGKCSSHEALILSIKLQKEKEKANANKELEKIISERKKSKSSSDKKKG
KEDKKERKRDREDKDKKSKEERKKEKKEKKEKKREKRAKPSDPAAESGKQDFVAKLSKPE
NVLVEFNGKLQKTNAELLERSSVTEEHGQPIDSHNAPCSSDSTGNSGKRKRSMPSPSGIQ
SNGNIIRIRLSSSSQKRDETSTSGSKGQEVSQLPQVREDPVLLHSQVRPCDSRATQDASV
RQKDVVSEAQSLLPCSTSTSTATLQRVSAEASGLKAEVSQKGILPLLDKVNTLEKLSSHD
RRMQKKESTYKQLFVDWVPPALEMVEEDDGDWLFGKKDEDRSAKRLRASNDVQSQVDNLP
CSASAVMQPRAQYLANAEIYALPFTVPF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatgttatccatacccgccacctgggtatgctgggaagtgctcaagccacgag
gccttgatcttatcgattaagctccaaaaagagaaggagaaggcaaacgcaaacaaggaa
ctagagaagatcatttcagaaaggaaaaagtccaaatcatcttcagataagaagaaaggc
aaagaagataaaaaagagaggaagagagacagagaagacaaggacaagaaaagcaaagaa
gaacggaagaaagagaagaaagaaaagaaagaaaagaagagagagaagagggctaagccc
agtgaccctgctgctgaaagtgggaagcaagattttgttgctaagttaagtaaacccgaa
aatgtgctggtcgaatttaatgggaagctgcagaagacaaatgctgaactgctggagagg
agtagtgttactgaagaacatggccagcccattgactctcataatgcgccttgctcttct
gatagcaccggaaacagtggcaagagaaaaaggtcaatgccatctcctagtggtattcag
agcaatggaaacataattagaattcggttgtcatcatcatctcaaaaaagagatgaaact
agtacatcaggaagcaaagggcaagaagttagtcagcttccacaggttagagaggaccct
gtcttattacatagccaagtgcggccttgcgacagccgtgcaacacaagacgcatctgtc
agacagaaagatgtagtctcagaagctcaaagtctacttccctgttctacttccacaagt
actgctactttacaacgagtttcagctgaagcttctggtttgaaagcagaagtatcccag
aagggtattcttccattgctggacaaggtcaacacgttggagaaactatcctctcatgac
agaaggatgcagaaaaaagaatcgacttataagcaattgtttgtggattgggtgccacct
gcactagaaatggttgaagaagacgacggagattggctttttggtaagaaggatgaagac
agatcagccaaaagattgagagccagtaatgatgttcaaagtcaggttgacaatcttcct
tgctcggcgtctgctgtaatgcagccacgggcccaatacttggccaatgcagaaatatat
gcattgcccttcactgttccgttctaa

DBGET integrated database retrieval system