KEGG   Chenopodium quinoa (quinoa): 110723769Help
Entry
110723769         CDS       T05764                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi00030  Pentose phosphate pathway
cqi00051  Fructose and mannose metabolism
cqi00052  Galactose metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01200  Carbon metabolism
cqi01230  Biosynthesis of amino acids
cqi03018  RNA degradation
Module
cqi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110723769
   00030 Pentose phosphate pathway
    110723769
   00051 Fructose and mannose metabolism
    110723769
   00052 Galactose metabolism
    110723769
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    110723769
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqi01009]
    110723769
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cqi03019]
    110723769
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     110723769
Protein phosphatases and associated proteins [BR:cqi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110723769
Messenger RNA biogenesis [BR:cqi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     110723769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 110723769
NCBI-ProteinID: XP_021758835
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MATISPAIASNFTPPPSTAAKSSNFFSGVGNRGFRLNFPTKTTRGRKSGNLSVLGCAESR
NPPEEIDLSDPNWKIKYERDFEQRFNLPHLTDVFKDLKPRPSTFCLKMRSPVSEDFAGGY
PSDEKWNGYINNNDRVLLKVIRYSSQDSAGAECIDPDCTWVEQWVHRAGPREEIYFRPEE
VNAAIVTCGGLCPGLNDVIRQIVITLDIYGVKNIVGIPFGYRGFTDKGIKEMPLSRKVVQ
NIHLSGGSLLGVSRGGPTVREIVDSMEERGTNMLFVLGGNGTHAGAVAIHNECRKRRMKV
SVVGVPKTIDNDILLMDKTFGFDTAVEEAQRAINSAYIEAHSAYRGVGLVKLMGRSSGFI
AMHASLASGQVDICLIPEVPFHIHGPHGILRHLEYLLDTKGSAVICVAEGAALNLLEKSN
ATDASGNAVFGDIGVHIQQEIKKYFKELGTSADVKYIDPTYMLRAIRANASDGILCTILG
QNAVHGAFAGFSGITVGLCNTHYAYFPIPEVIKYPRLVDPNSRMWHRCLTSTGQPDFI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaatttcgccggcgatcgcctccaatttcaccccaccgccgtcaacggcggcg
aaatcgagtaatttcttttccggcgtcggaaaccgagggtttcggttgaattttccgacg
aaaacgacacgtggcaggaaaagcgggaatttgtcggtgttaggttgcgcggagagtagg
aatccaccggaggagattgatctgagtgatccaaattggaagattaagtatgagcgtgat
tttgagcagcggtttaatttgccgcatcttactgatgttttcaaggatcttaaacctagg
ccttctacattttgccttaaaatgcggtctccggtgagtgaagattttgcaggtgggtat
ccatcagatgagaaatggaatgggtacattaacaacaatgacagagttttgttaaaggtc
atccgctattcctcgcaagattcagctggtgcagaatgcattgatcctgattgtacctgg
gtggagcaatgggtacatcgtgctggaccaagagaagagatatatttcagacccgaagaa
gtgaatgcagcaatagttacttgtggaggtctttgtccgggtcttaatgatgtcattaga
cagattgtaatcacacttgacatatatggtgtaaaaaacattgtaggcattccatttggg
tatcgtggttttacagacaagggcataaaggaaatgccactatcacggaaagttgttcag
aacattcacctctctggggggagtttattaggagtttcacgaggtgggccaactgtcaga
gaaattgtggacagtatggaggaaagaggaactaatatgctttttgttctgggtggaaat
ggaacacatgctggtgcagtagcaattcataacgagtgccgaaaaagacgaatgaaggtt
tctgttgttggtgtgccaaagactatagataacgacattttgcttatggacaagaccttt
ggttttgatacagctgttgaggaagcacaaagagccattaactctgcatacattgaggca
catagtgcttatcgtggtgttggccttgtaaaattgatgggtcgaagcagtggtttcata
gcaatgcatgcttcccttgctagtggccaagttgatatttgcttgataccagaggtacca
tttcatatacatgggccgcatggtattttgaggcatctcgagtacctacttgatacaaag
ggatcagctgtcatctgtgtagctgagggagctgcgctgaatcttcttgagaaaagtaat
gccactgatgcatccggtaacgctgtctttggtgatattggtgtgcatattcaacaagag
ataaagaaatattttaaggagcttggaacatcagctgatgtcaagtacattgatcctact
tacatgcttcgtgcaattcgtgcaaatgcctcagatgggatcctctgcactattttaggg
caaaatgctgttcacggagcatttgctggcttcagtggaatcacagtgggtttgtgtaac
actcattatgcctacttccctatacctgaagtcataaaatacccacggcttgtggatcct
aacagccgtatgtggcaccgttgcttgacctcaactggccagcctgattttatttaa

DBGET integrated database retrieval system