KEGG   Chenopodium quinoa (quinoa): 110730872Help
Entry
110730872         CDS       T05764                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110730872
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110730872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110730872
NCBI-ProteinID: XP_021766395
LinkDB All DBs
Position
Unknown
AA seq 233 aa AA seqDB search
MQAALAAMAAHSILASAPSHPTFSLLSPFSSTPTTSSATTLSSSLKSSSFNGVSFKLSSH
TQSLSLSAPAASKPLTIVAATKKAVAVLKGTSEVEGVVTLTQEDDGPTTVNVRITGLTPG
KHGFHLHEFGDTTNGCMSTGPHFNPNKMTHGAPEDEVRHAGDLGNIVANTDGVAEATIVD
NQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcattggcagccatggcagcacacagcatccttgcatccgcaccttcacat
cccacattctctctcctctctcctttctcttccacacccactacttcttctgctactacc
ctttcatcttcccttaaatcttcttccttcaatggtgtttctttcaagctttcttcccac
actcaatccctctctctttccgctcccgccgcctccaaacctctcaccattgttgctgct
accaaaaaagctgttgctgttcttaagggtacttccgaggttgagggtgttgttactttg
acccaggaagacgatggtccaactacagtcaatgttcgtattaccggacttactcccggg
aagcatggatttcacttgcatgagtttggagatacaacaaatgggtgcatgtccacaggt
ccacattttaatcctaataaaatgacacatggtgctccggaagatgaagtccggcatgcg
ggtgacctgggaaacattgttgctaacacagatggagtggctgaggctaccattgttgat
aatcagattccattgactggaccaaattcagttgtcggtagagcccttgtggtacatgaa
ctagaggatgaccttggaaagggtggacatgaacttagtctgaccactgggaatgctggt
ggaagattggcttgtggtgttgttggcttaactccagtgtaa

DBGET integrated database retrieval system