KEGG   Chenopodium quinoa (quinoa): 110739378Help
Entry
110739378         CDS       T05764                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP59-like
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110739378
   03110 Chaperones and folding catalysts [BR:cqi03110]
    110739378
Enzymes [BR:cqi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110739378
Spliceosome [BR:cqi03041]
 Complex C
  Other components
   PPlases
    110739378
Chaperones and folding catalysts [BR:cqi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110739378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1 zf-CCHC
Motif
Other DBs
NCBI-GeneID: 110739378
NCBI-ProteinID: XP_021775525
LinkDB All DBs
Position
Unknown
AA seq 559 aa AA seqDB search
MSVMVETSLGEFVIDLFIERCPLTCKNFLKLCKIKYYNGCLFHTVQKDFTAQTGDPTGTG
SGGNSIYKFLYGDQARFFKDEIYPDVKHSKMGTVAMASAGENLNASQFYITLRDELDFLD
EKHTVFGEIAEGHETLTRINEAYLDEKGRPFKNIRIKHTYVLDDPFEDPPQLASLIPDAS
PEGKPKEEVDDDVRLEDDWEPMDEQLPPEELEEAIRTKEAHSRAVVLESIGDIPDADVKP
PDNVLFVCKLNPVTEDEDLHTIFSRFGTVTSAEVIRDFKTGDSLCYAFIEFESNDACERA
YFKMDNALIDDRRIKVDFSQSVSKLWNQFRRKGTQGRGCFKCGALDHVAKNCSMGEMPGQ
HQKYVLKEDNQQHGGNRDAGYEMVFDEDGGSPKREKRHRDYEPDRKRHKSERRDHGDDKH
RRDGKNRDSRDSERRRYKNDDHDGHGGRRDERERGNSHVRDGKERERSHGREDRNRKESR
YDRRIDQDCREKKNDGDNRKMTENIGILSKRDGADRSKDRDRRRDSDFYEPSRKEVQNQR
RSSRDYTHGNNERRRTDRR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttatggtggaaacaagtttgggtgaattcgtgattgacttattcattgaacgt
tgtccgttaacttgtaaaaacttcttgaagctttgcaagatcaaatactacaatggttgt
ttatttcacacagtgcagaaggattttacagcgcaaactggtgatccaactggaacagga
agtggcggcaactctatctataagtttttatatggtgaccaagctcggttcttcaaagat
gaaatttaccctgacgtgaagcactcaaaaatgggtactgttgcaatggctagtgctggg
gagaatttgaatgcgtcccagttctacataacattaagagatgagcttgacttcctggac
gagaagcatactgtctttggggagattgcagaaggtcatgaaacactaacgagaataaat
gaagcttatttggatgagaagggaagaccatttaagaatataaggataaagcacacttac
gtgcttgacgatccttttgaagaccctccccagctggccagtttaatacctgatgcttca
ccagaaggcaaaccaaaagaagaggttgatgatgatgtgagactagaagatgattgggaa
cctatggacgaacaattacctccagaagagctggaggaagctatacgtacaaaggaagca
cactctagggctgtggttcttgaaagtattggtgacattccagatgctgatgtaaaacct
cctgataatgtgttgtttgtatgtaaacttaatccggtgactgaggatgaggacttgcat
actatattctcacggtttggaactgttacatcggctgaggtcatccgtgatttcaagact
ggtgacagcctgtgttatgctttcattgagtttgagagtaatgacgcttgcgagcgagct
tacttcaagatggacaatgcactaattgatgacaggaggataaaagttgattttagtcaa
agtgtttctaagctctggaatcaatttagacggaaaggaactcaaggaagaggatgcttc
aaatgtggtgcactagatcatgttgcaaaaaattgctccatgggagaaatgcctggtcag
catcagaaatatgttctaaaagaagataatcagcagcatggtggaaatagagatgcaggc
tatgagatggtgtttgatgaagatggtggaagcccaaaaagagaaaagaggcaccgagat
tatgagccagataggaaacgacacaaatctgaaaggagggatcacggtgatgataaacac
aggcgtgatgggaagaatagagactcaagggacagtgagagacgtcgatacaaaaatgat
gatcatgatgggcatggtggccgaagggatgaaagggagagaggtaatagtcatgtcagg
gatggcaaggaaagagagagaagtcatgggagggaagacaggaatcggaaagagagtagg
tatgatcgcaggattgaccaggattgccgagagaagaaaaatgatggggataacagaaaa
atgactgaaaatataggtatattgagcaagagagatggagctgataggagtaaggacagg
gataggaggagagattcagatttttatgagccaagcagaaaggaagtgcaaaatcagaga
agaagctcaagagattacactcatggcaacaatgagaggcggcgaactgacaggaggtga

DBGET integrated database retrieval system