KEGG   Chenopodium quinoa (quinoa): 110740036Help
Entry
110740036         CDS       T05764                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00250  Alanine, aspartate and glutamate metabolism
cqi00410  beta-Alanine metabolism
cqi00430  Taurine and hypotaurine metabolism
cqi00650  Butanoate metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Module
cqi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110740036
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110740036
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110740036
   00430 Taurine and hypotaurine metabolism
    110740036
Enzymes [BR:cqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110740036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110740036
NCBI-ProteinID: XP_021776217
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MALSKAASESDASIHSTFASRYVRVCLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDAINKNYVDMDEYPVTTELQNRCVNMIANLFNAPLKDSEVAVG
VGTVGSSEAIMLAGLAFKRRWQNKRRAAGLPIDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLEAKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCQENAVILKNGIEK
TGRFNIISKDIGVPLVAFSLKDNSIHNEFEISDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLADRLVADIQKVLSELDAQPARASAKLNAANSEDGTQQMTRKKSALEMQMEV
CSVWKKFVDERKLKTNGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgctctcaaaagctgcatctgaatccgatgcttcaattcactctacttttgcttca
agatatgtccgcgtatgtcttcccaggtttaagatgccagaaaattcgataccaaaggaa
gcagcgtaccaaataataaacgatgaattaatgttggatggaaatccaaggttgaatttg
gcttcgtttgtaacaacatggatggagcccgaatgtgataagcttatgatggatgccatc
aacaaaaattatgttgacatggatgaataccctgtcaccactgagctccagaataggtgc
gttaacatgatagcaaacttatttaatgcgccactaaaagactcagaggtggctgttgga
gttggaactgtgggctcctcagaagctatcatgcttgctggtttggctttcaaaagaagg
tggcaaaacaaaaggcgggctgccggcctacccattgacaagcccaacatcgttactggt
gccaacgttcaggtatgttgggagaaatttgcaagatatttcgaggtggagttgaaggaa
gtcaagctaagcgacggatactatgtcatggaccctgagaaggctgtggaaatggttgat
gagaacactatctgtgtcgcggccatccttggatcaactctcaatggagaattcgaagat
gttaagctcttgaacgacctcctcgaggccaagaacaaagaaacaggatgggatactcca
attcatgtggatgcagcaagtggtggattcatcgcgccatttatataccctgagttggag
tgggactttcgattgccattggtgaagagtatcaatgtaagtggtcacaagtacggactt
gtgtatgccggtgttggttgggttatttggaggagcaaggaggacttgcctgaagaactc
atctttcatattaactaccttggtgctgatcaacccactttcactctcaatttttctaaa
ggatcaagtcaaattattgcgcaatactatcaattgattcgtttgggatttgagggatac
aagaatatcatggaaaactgccaagaaaacgcggtgatcttgaagaatggaattgaaaaa
actggccgcttcaacatcatatcgaaggatataggagttccattagtggcattctcttta
aaagacaatagtatccacaatgagttcgagatctcagacatgcttcgtaggttcgggtgg
attgtaccagcttacaccatgcccccagacgcgcaacatgtgacagtgttgcgtgttgtc
atccgagaggacttctctcgcacccttgcagaccgacttgttgctgacatccaaaaggtg
ctcagcgagcttgatgcccaacctgctcgcgctagtgctaagctaaatgctgcgaactca
gaggatggtactcaacaaatgactaggaagaagagtgccttggaaatgcaaatggaggtt
tgcagtgtttggaagaaattcgtcgatgaaaggaagttgaagaccaatggtgtttgctag

DBGET integrated database retrieval system