KEGG   Chenopodium quinoa (quinoa): 110740304Help
Entry
110740304         CDS       T05764                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00020  Citrate cycle (TCA cycle)
cqi00190  Oxidative phosphorylation
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110740304
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110740304
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110740304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_18 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 110740304
NCBI-ProteinID: XP_021776485
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MASSLLRRATTSPLSRLLLSRLHASDASASASAAPSPPPKSMKTFQIYRWNPDNPSKPEL
KNYEINLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKID
SSASAASMITPLPHMFVVKDLVVDMTNFYNQYKSIEPWLKRKNPATTPGKEYLQTKEDRK
KLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHAHRWIADSRDEYTEERLEAINDEF
KLYRCHTIMNCTRACPKGLNPAKQIQQIKRLEHAK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgagtctcctccgccgcgccacaacctctccgctcagccgcctcctcctctcc
cgcctccacgcctccgacgcctccgcctccgcctccgccgcaccatcgccgccaccaaaa
tcgatgaaaaccttccaaatctaccgctggaaccccgacaatccttccaaacccgagctc
aaaaactacgagatcaatctcaaggagtgcggtcccatggtcctcgacgctctcatcaag
atcaagaacgaaatcgacccgtctctcaccttccgccgatcttgccgcgaaggaatttgt
ggctcctgcgctatgaacatcgacggttgtaatggcctcgcttgtcttacgaagatcgat
tcgtctgcttcggctgcttcgatgattacgccgttgccgcatatgtttgtggttaaggat
ttggtggttgatatgaccaatttctataatcagtataagagtattgagccttggttgaag
aggaagaatcctgctactacgcctgggaaagagtatcttcaaactaaggaggataggaag
aagttggatggaatgtatgagtgtattctttgtgcttgttgtagtacttcctgccctagt
tattggtggaatcctgaatcttatttgggtcctgctgctttgcttcatgctcatcgatgg
atagctgatagccgtgatgagtacactgaggagcgactggaggcaattaatgacgagttc
aagctgtataggtgccatactattatgaactgtactcgtgcctgcccaaagggtttgaac
cctgcaaagcagattcaacagattaaacgtctcgagcatgctaagtga

DBGET integrated database retrieval system