KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000031Help
Entry
CpipJ_CPIJ000031  CDS       T01079                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00480  Glutathione metabolism
cqu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CpipJ_CPIJ000031
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CpipJ_CPIJ000031
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     CpipJ_CPIJ000031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 6030837
NCBI-ProteinID: XP_001841701
VectorBase: CPIJ000031
UniProt: B0VZ90
LinkDB All DBs
AA seq 257 aa AA seqDB search
MSSGKHLANGSTPPALGKDGKLRLYSMRFCPYAQRIHLILDAKNIPYHTIFINLTEKPEW
YFEKNPLGKVPALEVPDKENITLYESLVVADYIEEAYSDKKRKLYPADPFQKAQDRILIE
RFNGAVISPYYRILFSSDGIPPGAITEFGTGLDIFEKELKSRATPYFGGDKPGMLDYMIW
PWCERVDLLKFALGDKYELDKERFGKLLQWRELMEKDEAVKQSFLSTESHTKFLQSRKSG
ENNYDILSNDAKRLRAA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggaaagcatttggccaatggatccaccccaccggcactgggcaaagatggc
aagttgcgcctttactcgatgcgattctgcccgtacgcccagcgtatccatctaatcttg
gacgccaagaacatcccgtaccacacgatcttcatcaacctgacggagaagcccgagtgg
tactttgagaagaatccgctcggcaaggttccggcgctggaagttcccgacaaggaaaac
atcaccttgtacgagtcgctcgtggtggccgactatatcgaggaagcgtactcggacaag
aagcgcaaactctacccggccgatccgttccagaaggcgcaggaccgcattctgatcgaa
cgcttcaatggagcggtcatctcaccgtactaccggattctgttctccagcgacggcatt
ccaccgggtgccatcaccgagttcggaacggggttggacatcttcgagaaggaactgaaa
agccgagccacgccgtactttggaggcgacaaacccggaatgctcgactacatgatctgg
ccgtggtgtgagcgggtcgatctgctgaagtttgccctaggagacaagtacgagctggac
aaagaacggttcggtaaattgcttcagtggcgcgaacttatggaaaaggacgaagcggtc
aagcaatcattcctctcgactgaaagccacaccaagtttctgcagagccggaagtctgga
gagaacaactacgatatactttcaaacgatgcaaaacgactgcgtgccgcataa

DBGET integrated database retrieval system