KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000671
Entry
CpipJ_CPIJ000671  CDS       T01079                                 

Definition
(GenBank) caspase
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ000671
   04215 Apoptosis - multiple species
    CpipJ_CPIJ000671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ000671
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     CpipJ_CPIJ000671
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ000671
SSDB
Motif
Pfam: Peptidase_C14 RNase_H_2
Other DBs
NCBI-ProteinID: EDS41304
VectorBase: CPIJ000671
UniProt: B0W0K2
LinkDB
AA seq 305 aa
MSDTGLIEDQQPIQADVQDSNKTSTTKFTDVADALGHGNGLDHYGNRLKARMPVDRYASD
YNMNHPKRGLALIFNHEHFEIPQLKSRAGTNVDCENLASTLKHLDFDVRVYKDMKLRDMQ
KEVEKVAKMDHSDNDCILITILSHGELGYLYAKDCQYKLDIIWSYFTANHCPTLAGKPKL
FFIQACQGDQLDAGVTLSDRTETDSAGSMSYKIPAHADFLIAYSTIPGFYSWRNTQKGSW
FMQSLCQELNQHGKKYDILTLLTFVAQRVAYDFESNTPDIPMMHQQKQIPCVTTMLTRLL
RFTDK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgagtgacactggcttgatcgaggaccagcagccgatccaggccgatgtgcaggattcc
aacaaaaccagcaccaccaaattcacggacgttgccgacgccttgggacacggaaatggc
ttagaccattatgggaaccggctgaaggcgcggatgcccgtcgatcgctatgcttccgac
tacaacatgaaccacccaaagcggggtctggccctaatcttcaaccacgagcattttgag
attccgcagctcaagtcacgggccggcactaatgttgactgcgaaaatttggcatccacg
ctgaagcatctggactttgacgtgcgcgtgtacaaggacatgaagctgagggatatgcag
aaggaggtggagaaagtcgccaagatggaccactcggacaacgactgcatcctgatcacg
atcctgtcgcacggcgaactcggctacctgtacgcgaaggattgccagtacaagctagac
atcatttggtcgtacttcactgccaaccattgcccgaccctggctggtaagccgaagctg
tttttcattcaggcctgccagggtgaccagttggacgcgggcgtcaccctgtccgatcgc
accgaaacggacagcgccggctcgatgagctacaaaattccggcccacgccgacttcctg
atcgcgtactcgaccatcccgggtttctactcgtggcgcaacactcaaaagggctcctgg
ttcatgcagtccctgtgccaggagttgaaccagcacggaaagaagtacgacattctgacg
ctgctgacgttcgtagcccagcgggtggcgtacgactttgagtccaacacgccggacatt
ccgatgatgcaccagcagaagcagatcccgtgcgtgacaaccatgttgacgcgactgctg
cgctttactgacaagtag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008252
Entry
CpipJ_CPIJ008252  CDS       T01079                                 

Definition
(GenBank) caspase
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ008252
   04215 Apoptosis - multiple species
    CpipJ_CPIJ008252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ008252
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     CpipJ_CPIJ008252
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ008252
SSDB
Motif
Pfam: Peptidase_C14 LemA XdhC_C
Other DBs
NCBI-ProteinID: EDS30609
VectorBase: CPIJ008252
UniProt: B0WLP4
LinkDB
AA seq 291 aa
MSKQVVTENPEYSSSANLYDTTNDYRGLALVFNHENFETEKKRDGTNEDRDNLKDLLSSL
KFDVHIYDDLNKKEVLKTLKIWSEEKYSDCDCLVVVVMTHGDPHNLYAKDSCYPVESLWV
NFIGNRCPSLIGKPKMFFIQACRGKALDQGVVFDPERQNDKKDCKTYEGSNSSPPMADLL
VMYSTYEGHCSWRNPKDGGVFIQTLCSELKANGNKRELLTLLTGVSRRTAYEFQSYVPDD
EKYNAKKQMPCLVSTLTKSFYFTDKTTSKKFELKKFRLCKDVEEHLNNNKD
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtccaaacaagttgtaactgaaaatcctgagtattcctcttctgcaaatctctacgat
acaacgaatgattatcggggacttgcgttggtgtttaatcatgaaaactttgagacggaa
aaaaagcgagatggcaccaatgaagatcgggataacttgaaagatctactgagtagtctt
aaatttgatgtgcacatatatgatgacttgaacaagaaggaagtgctgaaaacactgaag
atatggtctgaagaaaaatactcggactgcgactgcctagtagtggttgtgatgactcat
ggtgatccacataatttgtacgctaaagattcatgctacccagtggaatctctttgggta
aactttatcgggaacaggtgcccctcgctgattgggaagcccaagatgttctttatacaa
gcgtgtcgaggaaaagctcttgaccaaggagtggtgttcgatcctgaaagacaaaacgac
aaaaaggattgtaaaacatacgaaggttcgaattcgagcccgccaatggctgatttattg
gtgatgtattcgacatatgaagggcactgctcgtggcgtaatcccaaagatggcggggtg
tttatccagacgctatgcagtgagctgaaggcgaacgggaataaacgtgagcttttgacg
cttctaactggtgtgtctagaagaacggcatatgaatttcagtcatatgttccagatgat
gagaagtacaacgccaagaagcaaatgccgtgcctggtttcgactctgactaagagcttt
tactttactgataagacaactagcaagaaatttgagctgaaaaagtttcgactctgtaaa
gatgttgaagaacatttaaacaacaataaagattaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008253
Entry
CpipJ_CPIJ008253  CDS       T01079                                 

Definition
(GenBank) caspase-1
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ008253
   04215 Apoptosis - multiple species
    CpipJ_CPIJ008253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ008253
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     CpipJ_CPIJ008253
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ008253
SSDB
Motif
Pfam: Peptidase_C14 Phage_Mu_Gam DUF5828
Other DBs
NCBI-ProteinID: EDS30610
VectorBase: CPIJ008253
UniProt: B0WLP5
LinkDB
AA seq 169 aa
MDKGSTNEVDVLGLMEYIPNSSMPSANITPKSRPTVEENYNTNHKYRGLALIFCNMEFQK
ELKMPKRVATEKDRDDICDALENLSFNVKVNNDLNKEEVQKTLKEWSQEKHHIDNDCLVV
VIMTYGGNGFVYAKDGKYEVDTLWKNFVGNACPSLIGKPKIFFIQGLYG
NT seq 510 nt   +upstreamnt  +downstreamnt
atggacaaaggatcgacaaacgaagtggatgttctaggattaatggagtacataccaaac
tcatcgatgccatcggctaacataactcccaagtctcgacctactgtggaggagaattac
aacacaaaccataagtatcgagggctagcgttgatattctgtaatatggagtttcagaaa
gagttgaaaatgccaaaacgagttgctacagaaaaagatcgtgacgacatatgtgatgca
ttggagaatctgtcttttaatgtaaaagtgaacaatgacctgaataaggaggaagtgcag
aaaactttgaaggagtggtcccaagaaaaacaccacatagacaatgactgtctggtagtg
gtcatcatgacctacggtggaaacggattcgtctatgccaaagatggaaaatatgaagtg
gatacactgtggaaaaactttgtcgggaatgcgtgtccttcgcttataggaaaaccaaaa
atattctttattcaaggactgtatggctag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009056
Entry
CpipJ_CPIJ009056  CDS       T01079                                 

Definition
(GenBank) caspase-3
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ009056
   04215 Apoptosis - multiple species
    CpipJ_CPIJ009056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ009056
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     CpipJ_CPIJ009056
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ009056
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-ProteinID: EDS32339
VectorBase: CPIJ009056
UniProt: B0WPG0
LinkDB
AA seq 275 aa
MKKIMFGRKESGPSLNSPAVPPPAYTIDRYSSYYPMNHKNRGKAIIFTHAVFAVPNVKLP
AREGSEVDCKALTESLERLGFDVDLYRDKRLKDILHITEKVSLMDHSSSDCLLVAVLTHG
DEGEIIYAHDCPYQISSVWTQFTGDRCPTLIGKPKIFIIQACRGNELDQGVKVEKDGVAR
YSIPTHADFLFAFATIPGFMSFRNTRNGSWFIREFCNELNENGQRYDLLTLLTFVVQKVA
YGYESIAPNTPEYHLKKQTPCIVSMLTRLLLFNYV
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaaaaaatcatgtttggccgaaaagaaagtggtccctcgctgaatagtccggcagtg
ccaccgccagcttacaccatagatcgctactcttcctactatccgatgaatcacaagaat
cgagggaaggccataattttcacccacgccgtgttcgctgtgccaaatgtaaagcttcca
gccagggaaggcagcgaagtggactgcaaagcgctgaccgaatcgctggaacggctgggc
ttcgatgtggacctgtaccgggacaagcgattgaaggacattcttcatatcacggagaaa
gtttcgttgatggaccactcgagctcggactgtctgctggtggccgtgctgacacacggt
gacgagggggaaattatctacgcccacgattgtccgtaccagatttcgagcgtttggaca
cagttcaccggcgatcgctgcccgacgctgattggaaagccaaagattttcatcattcaa
gcctgcagggggaacgagctggaccagggcgtgaaggttgaaaaggatggcgtcgcacgg
tacagcattcctacgcacgcggactttctgtttgcttttgccaccattcccgggttcatg
tcgttccgtaacacccgcaacgggtcgtggttcatacgggagttttgcaacgaactgaac
gaaaatggacagcgatacgatctattgacgctgcttaccttcgtggtccagaaggtggcc
tacgggtacgagtcgattgcccccaacacgccggaatatcacctcaaaaagcaaacacca
tgcattgtgtcgatgctgaccagactgttgttgtttaactatgtttaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009057
Entry
CpipJ_CPIJ009057  CDS       T01079                                 

Definition
(GenBank) caspase-3
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ009057
   04215 Apoptosis - multiple species
    CpipJ_CPIJ009057
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ009057
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     CpipJ_CPIJ009057
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ009057
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-ProteinID: EDS32340
VectorBase: CPIJ009057
UniProt: B0WPG1
LinkDB
AA seq 285 aa
MSTLSLTMERAKKAQFWRRGSSFSPSRLPVNPAYVIDRTGAYYPMNHKRRGKALIFTHET
FAKSTKLASRKGAKVDSKALGKSLKRLGFDVDIYSDKGKEEINKITEKASRQDHSNADCL
LVAILTHGDDGDSLCAQDGSYQFTSVWSQFTEERCPSLAGKPKIFIVQACRGQELDPGVA
TVEQDGIARYIGSAEANFLFAFATAPGFMSFRNVESGSWFIQELCVELNENGERYDLLTL
FTFVTQRVAHLHESNAPDTLEYHQKKQIPCIVSKLTRLLLISGRG
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtcaacgttatcgttaacgatggaaagggcaaagaaggctcaattttggcgcagagga
agcagcttttcgccaagccgtcttccggtgaatccagcctacgtaattgatcgcactggt
gcgtattacccgatgaatcataagcgtcgcggaaaggcgctgatcttcacgcacgaaacg
tttgcgaaatccacgaaactagcgtcgagaaaaggcgcaaaagtggacagcaaggcgctc
ggaaagtccctgaaacggcttggtttcgacgtggacatctattccgataaaggaaaagag
gaaataaataaaatcaccgagaaagcttctcgtcaagatcactcaaacgcggactgtctg
ctggttgctattctaacccacggcgatgatggggactccctttgtgctcaagatggttcg
taccagttcacgagcgtgtggtcacaattcaccgaagagcgctgtccatcgttggccgga
aagcccaaaatatttatagtccaagcctgccgaggccaagagctggatccgggagttgcg
acggttgagcaggatggaatcgcacggtacatcggttcggcggaagcaaattttttgttt
gcattcgccaccgcaccagggtttatgtcatttcggaacgtcgaaagcggatcgtggttt
attcaggagctttgcgttgaactgaacgaaaacggagaacggtacgatctgctgacgcta
tttactttcgttactcaacgggtagcccatctacatgaatcgaatgctcccgatacactg
gagtaccatcagaaaaagcaaataccgtgcattgtttcgaaattaacaaggcttttgttg
ataagtggaagaggttga

DBGET integrated database retrieval system