KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001156
Entry
CpipJ_CPIJ001156  CDS       T01079                                 

Definition
(GenBank) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04013  MAPK signaling pathway - fly
cqu04068  FoxO signaling pathway
cqu04137  Mitophagy - animal
cqu04140  Autophagy - animal
cqu04141  Protein processing in endoplasmic reticulum
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
cqu04310  Wnt signaling pathway
cqu04391  Hippo signaling pathway - fly
cqu04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ001156
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ001156
   04310 Wnt signaling pathway
    CpipJ_CPIJ001156
   04391 Hippo signaling pathway - fly
    CpipJ_CPIJ001156
   04068 FoxO signaling pathway
    CpipJ_CPIJ001156
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ001156
   04137 Mitophagy - animal
    CpipJ_CPIJ001156
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ001156
   04215 Apoptosis - multiple species
    CpipJ_CPIJ001156
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    CpipJ_CPIJ001156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ001156
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CpipJ_CPIJ001156
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CpipJ_CPIJ001156
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Kdo TCAD9 Pkinase_fungal
Other DBs
NCBI-ProteinID: EDS28190
VectorBase: CPIJ001156
UniProt: B0W262
LinkDB
AA seq 376 aa
MAYANFPLPELLNEINNNASNTEFTVPGRFQNLFPIGIGAQGAVCAAMDVVTGRPVAIKK
LSRPFQDVTHAKRAYREIKLMRLVDHPFIIKLLHAYSPQNSLDTFRDIYLFTERMDTNLS
VVIGNPLDHERLSFLVYQMLCGVKYLHSAGIIHRDLKPTNIVVRADCSLKILDFGLAKVV
GTNFMMTQYVVTRYYRAPEVILNMEYDTKVDIWAIGCIMAELITGRVLFPGTDHVDQWNK
IVETLGTPTPELIAKAPSSERRYIETLPVHPRPTIEQLFPDESFLATAAGSPELNNANAR
AMLARMLTIDPAERMSTEEALAHPYISLWFQEDEVNRQAPVPYDHALDEQELSLDQWKAL
LFQEIREIQAETLEAE
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcctacgcaaactttccccttcctgagttactcaacgaaatcaacaacaatgccagc
aacaccgagttcaccgttccgggccgcttccagaacctgtttccgatcggcatcggcgcc
cagggtgccgtttgcgccgcaatggacgtcgtaacgggacgacccgtggccatcaagaag
ctttcgcgaccattccaggacgtaacgcatgccaaacgtgcctaccgggagattaagctg
atgcgattggttgaccatcccttcatcatcaaactcctgcacgcatactccccccagaac
tcgctggacaccttccgggacatttacctgttcaccgagcgaatggacaccaacctgagc
gtcgtgatcgggaatccgttggaccacgagcggttgtccttcctcgtgtaccagatgctg
tgcggcgtcaagtacctgcattcagcgggaattattcatagggatctcaaaccaacgaac
atcgtcgttcgcgcggactgttcgctcaagattctggactttggcctggccaaggtcgtc
gggacgaacttcatgatgacccagtacgtggtgacgcgctactaccgagcccccgaggtc
atcctgaacatggagtacgacaccaaggtggacatttgggcgatcggttgcatcatggcg
gaactcatcaccggccgggtgctcttccccggcaccgaccacgtcgaccagtggaacaag
atcgtcgaaacgctcggaacgccaacaccggagctcatcgccaaggcgcccagctccgag
cggcgttacatcgaaaccctccccgttcacccgcgaccaacgatcgagcagctcttcccg
gacgagtccttcctggcgacggccgccggttcgccggaactgaacaacgcgaacgcccgc
gccatgttggcccgcatgttgacgatcgatccggccgagcggatgtccaccgaggaggcg
ctcgcccatccgtacattagcttgtggttccaggaagacgaggtcaatcgacaggcgccc
gttccgtacgatcacgccctggacgagcaggagctcagcttggaccagtggaaggcgctg
ctgtttcaggaaattcgggagattcaggcggagacgttggaggcggagtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001157
Entry
CpipJ_CPIJ001157  CDS       T01079                                 

Definition
(GenBank) jnk
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04013  MAPK signaling pathway - fly
cqu04068  FoxO signaling pathway
cqu04137  Mitophagy - animal
cqu04140  Autophagy - animal
cqu04141  Protein processing in endoplasmic reticulum
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
cqu04310  Wnt signaling pathway
cqu04391  Hippo signaling pathway - fly
cqu04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ001157
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ001157
   04310 Wnt signaling pathway
    CpipJ_CPIJ001157
   04391 Hippo signaling pathway - fly
    CpipJ_CPIJ001157
   04068 FoxO signaling pathway
    CpipJ_CPIJ001157
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ001157
   04137 Mitophagy - animal
    CpipJ_CPIJ001157
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ001157
   04215 Apoptosis - multiple species
    CpipJ_CPIJ001157
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    CpipJ_CPIJ001157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ001157
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CpipJ_CPIJ001157
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CpipJ_CPIJ001157
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Kdo TCAD9
Other DBs
NCBI-ProteinID: EDS28191
VectorBase: CPIJ001157
UniProt: B0W263
LinkDB
AA seq 420 aa
MAYANFPLPELLNEINNNASNTEFTVPGRFQNLFPIGIGAQGAVCAAMDVVTGRPVAIKK
LSRPFQDVTHAKRAYREIKLMRLVDHPFIIKLLHAYSPQNSLDTFRDIYLFTERMDTNLS
VVIGNPLDHERLSFLVYQMLCGVKYLHSAGIIHRDLKPTNIVVRADCSLKILDFGLAKVV
GTNFMMTQYVVTRYYRAPEVILNMEYDTKVDIWAIGCIMAELITGRVLFPGTDHVDQWNK
IVETLGTPTPELIAKAPSSERRYIETLPVHPRPTIEQLFPDESFLATAAGSPELNNANAR
AMLARMLTIDPAERMSTEEALAHPYISLWFQEDEVNRQAPVPYDHALDEQELSLDQWKAL
LFQEIREIQAETLEAEAVESESESEPESVESGLFGDLESESESESSKLEQLESESEPESA
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcctacgcaaactttccccttcctgagttactcaacgaaatcaacaacaatgccagc
aacaccgagttcaccgttccgggccgcttccagaacctgtttccgatcggcatcggcgcc
cagggtgccgtctgcgccgcaatggacgtcgtaacgggacgacccgtggccatcaagaag
ctttcgcgaccattccaggacgtaacgcatgccaaacgtgcctaccgggagattaagctg
atgcgattggttgaccatcccttcatcatcaaactcctgcacgcatactccccccagaac
tcgctggacaccttccgggacatttacctgttcaccgagcgaatggacaccaacctgagc
gtcgtgatcgggaatccgttggaccacgagcggttgtccttcctcgtgtaccagatgctg
tgcggcgtcaagtacctgcattcagcgggaattattcatagggatctcaaaccaacgaac
atcgtcgttcgcgcggactgttcgctcaagattctggactttggcctggccaaggtcgtc
gggacgaacttcatgatgacccagtacgtggtgacgcgctactaccgagcccccgaggtc
atcctgaacatggagtacgacaccaaggtggacatttgggcgatcggttgcatcatggcg
gaactcatcaccggccgggtgctcttccccggcaccgaccacgtcgaccagtggaacaag
atcgtcgaaacgctcggaacgccaacaccggagctcatcgccaaggcgcccagctccgag
cggcgttacatcgaaaccctccccgttcacccgcgaccaacgatcgagcagctcttcccg
gacgagtccttcctggcgacggccgccggttcgccggaactgaacaacgcgaacgcccgc
gccatgttggcccgcatgttgacgatcgatccggccgagcggatgtccaccgaggaggcg
ctcgcccatccgtacattagcttgtggttccaggaagacgaggtcaatcgacaggcgccc
gttccgtacgatcacgccctggacgagcaggagctcagcttggaccagtggaaggcgctg
ctgtttcaggaaattcgggagattcaggcggagacgttggaggcggaggctgtggagtcg
gagtcggagtcggagccggagtcggtggagtcgggtctttttggggacctggagtcggag
tcggagtcggagtcgtcaaaactcgaacagctggagtcggagtcggagccggagtcggct
taa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001158
Entry
CpipJ_CPIJ001158  CDS       T01079                                 

Definition
(GenBank) jnk
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04013  MAPK signaling pathway - fly
cqu04068  FoxO signaling pathway
cqu04137  Mitophagy - animal
cqu04140  Autophagy - animal
cqu04141  Protein processing in endoplasmic reticulum
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
cqu04310  Wnt signaling pathway
cqu04391  Hippo signaling pathway - fly
cqu04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ001158
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ001158
   04310 Wnt signaling pathway
    CpipJ_CPIJ001158
   04391 Hippo signaling pathway - fly
    CpipJ_CPIJ001158
   04068 FoxO signaling pathway
    CpipJ_CPIJ001158
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ001158
   04137 Mitophagy - animal
    CpipJ_CPIJ001158
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ001158
   04215 Apoptosis - multiple species
    CpipJ_CPIJ001158
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    CpipJ_CPIJ001158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ001158
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CpipJ_CPIJ001158
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CpipJ_CPIJ001158
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like APH FTA2 TCAD9
Other DBs
NCBI-ProteinID: EDS28192
VectorBase: CPIJ001158
UniProt: B0W264
LinkDB
AA seq 376 aa
MSSSRHAFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRTLEEFQDVYLVMELMDANLCQVIQMD
LDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMTRLQPTVRNYVENRPRYTGYPFDRLFPDVLFPTDSNEHNRLKASQARDLLSKM
LVVDPEHRISVDQALVHSYINVWYDESEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVM
EYEARNNLADGDGTPR
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgagcagctcgagacacgcgttctacaccgtcgaggtgggcgacaccaagtttaccatc
ctgaagcgataccagaacctgaagccgatcggatccggtgcccagggcatcgtctgcgcc
gcgtacgacaccatcacccagcagaatgtcgccatcaaaaagctgtcgcggccgttccag
aacgtcacacacgccaaacgagcctacagggagtttaagcttatgaagttagtcaaccat
aaaaatataattggactgctgaacgcattcacgccgcagcgcacgctcgaggagttccag
gacgtgtacctggtgatggagctgatggacgccaacctgtgccaggtcatacagatggac
ctggaccacgagcggatgtcgtacctgctgtaccagatgctgtgcggcatcaagcatctg
cactcggccggaatcatacacagggatctaaaaccgtcaaacatcgtcgtcaaatcggac
tgcacgctcaagatcctggactttgggctggcccgcacagccggcaccaccttcatgatg
acgccgtacgtggtgacgcggtactaccgcgcccccgaggtcatcctgggcatgggctac
aaggagaacgtcgacatctggtcggtgggctgcatcatgggcgagatgatccgcggcggg
gtgctgttcccgggcacggaccacattgaccagtggaacaagatcatcgagcaactcgga
acgccgtcgccctcgttcatgacccggttacagccgacggtgcggaactacgtcgagaac
cggccccgctacaccggctacccgttcgatcggctcttcccggacgtgctcttcccgacg
gactcgaacgagcacaaccggctgaaggcgagccaggcgcgcgatctgctgagtaaaatg
ctcgtcgtcgacccggaacaccgcatctccgtcgaccaggcgctcgtccacagctacatc
aacgtgtggtacgacgagagcgaagtcaacgcgcccgcccccggcccgtacgaccacagc
gtcgatgagcgggagcacaccgtcgagcagtggaaggagctgatctaccaggaagtcatg
gagtacgaggcgcgcaacaacctcgccgacggcgacggcaccccgcggtag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ017823
Entry
CpipJ_CPIJ017823  CDS       T01079                                 

Definition
(GenBank) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04013  MAPK signaling pathway - fly
cqu04068  FoxO signaling pathway
cqu04137  Mitophagy - animal
cqu04140  Autophagy - animal
cqu04141  Protein processing in endoplasmic reticulum
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
cqu04310  Wnt signaling pathway
cqu04391  Hippo signaling pathway - fly
cqu04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ017823
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ017823
   04310 Wnt signaling pathway
    CpipJ_CPIJ017823
   04391 Hippo signaling pathway - fly
    CpipJ_CPIJ017823
   04068 FoxO signaling pathway
    CpipJ_CPIJ017823
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ017823
   04137 Mitophagy - animal
    CpipJ_CPIJ017823
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ017823
   04215 Apoptosis - multiple species
    CpipJ_CPIJ017823
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    CpipJ_CPIJ017823
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ017823
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CpipJ_CPIJ017823
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CpipJ_CPIJ017823
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like APH FTA2 Pkinase_fungal TCAD9
Other DBs
NCBI-ProteinID: EDS26881
VectorBase: CPIJ017823
UniProt: B0XFL8
LinkDB
AA seq 386 aa
MTTQYERYQFGDTEFEVPARYIHLEAKGFGAQGMVCAAYDTLFGRPVAIKKLSRPFQSAV
HAKRAYRELRLMKLVDHVNIIGLLDAFTPQRMFGLFQDVYLVMELMEANLCQVIQMELDH
DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVNSECKLKILDFGLARTVGSHFTMTSY
VVTRYYRAPEIILGMGYKENVDIWSIGCIFGEMIRGGVLFPGNDHIDQWNKIIEQLGTPD
STFMTRLQPTVRNYIENRPRYNGFPFDRLFPNLLFPDCSDGENRTKADQARDLLSRMLVI
DPDQRISVEQALQHSYINVWYDDREVNAPAPGPYDHSVDERELSVEQWRQLIYEEVREFE
VRNRAMFGEGSSRSPLVGCQLQTTTS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacgacccagtacgagcggtaccagtttggcgacaccgagttcgaagtcccggcgcgg
tacatccacctcgaggccaaaggcttcggcgcccagggcatggtgtgtgccgcgtacgac
accctgttcgggcggcccgtggccatcaagaagctgtcgagaccgttccagagtgcggtc
catgcgaaacgagcctaccgggagttgcggttgatgaagttggtcgatcatgtgaatata
attgggctgttggacgcgtttacgccgcagcggatgtttggactgttccaggacgtttat
ctggtgatggaactgatggaggctaatttgtgtcaggtgattcagatggagttggaccat
gatcggatgtcttacttgctgtaccagatgttgtgcgggattaagcacttgcattcggcg
gggatcattcacagggatttgaagccgtcgaacatcgtggtcaactcggagtgcaagctg
aagatcttggactttggactggcgaggacagttgggagtcactttacgatgacgtcttac
gtggttacgcggtactaccgcgctccggagatcatcctcgggatgggttacaaggagaac
gttgacatctggtctattgggtgcatcttcggcgagatgatccgcggtggcgtgctcttc
cctggcaacgatcacatcgaccagtggaacaagatcatcgaacagctgggaacgcccgac
tccaccttcatgacccgactccagccaaccgtccggaactacatcgagaaccgccctcgg
tacaacggatttccgttcgatcgactcttcccgaacctgctcttcccagattgctccgac
ggggagaaccgcaccaaagcggaccaagctcgggatctcctgagtcggatgctggtcatc
gaccctgaccagcgcatctccgtcgagcaggccctgcagcacagctacatcaacgtgtgg
tacgacgaccgggaagtcaacgccccggccccgggaccttacgatcacagcgttgacgag
cgggaactcagcgtcgagcagtggcgccagctgatctacgaagaggtgagggagtttgag
gttcgaaaccgggcgatgtttggcgagggcagttcaaggtcaccgctggttgggtgtcag
ctgcagacgacgacttcttga

DBGET integrated database retrieval system