KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001777Help
Entry
CpipJ_CPIJ001777  CDS       T01079                                 

Definition
(RefSeq) ataxia telangiectasia mutated
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu04068  FoxO signaling pathway
cqu04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ001777
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    CpipJ_CPIJ001777
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ001777
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ001777
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ001777
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ001777
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CpipJ_CPIJ001777
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   CpipJ_CPIJ001777
DNA replication proteins [BR:cqu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     CpipJ_CPIJ001777
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    CpipJ_CPIJ001777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT DUF3385
Motif
Other DBs
NCBI-GeneID: 6032931
NCBI-ProteinID: XP_001843451
VectorBase: CPIJ001777
UniProt: B0W417
LinkDB All DBs
AA seq 1315 aa AA seqDB search
MSPSDVIKTISAECVAFLVPKWANCANMSAKYTAKASAMEHVLGNQLDLKRFVSGEQNNL
RVLKLLTACCQDESRMVEMLEREVLIPSDEHVLTVENYLSCLTHYQSLINSKYSLVTYFC
MKHPAVIEQLLLDLKLKIYRSEVVEEKIKVLFQYSTVIDQLEEYFCQHRSTHLKEFLARD
ICYFLCHTMVSSKALHVPVLNCLKRFLEKELPTCAEYFRPYLNFLTSSLLSVYDHNTNEK
VALKTIHVLRLIVVDHQAMFGDAIGKLNHFPEDEAFKELRQALQQHKEQSLYKLTLAEDI
TRMIQLPSLKFEELTTMRSMLASRKDELRAICEELQASDGFSENCSQNALLRLINVLINE
IRSGSTDKHRIEALCCLGEIGPVDLSTMLLRSDAQQEIYKTSSSAEEAEEHLVQVMIVEL
NQLVVSRNVLVAEQAAIVCCHVLQIGRYRALANNLRTLVPYMVLAERDGRIFGAGPSGKL
NLSDALNAATSYESFVRVLVGMLLEFFQDKALKSLAEVEVAFAAKLIPLLVQIVLSLHDK
NLNDDVGNFVNTFFTMFSDNTNNGCLSKDLETIHLMLTIVECVRLNNQSNPQHKIDLNCL
TIAGASLHCHAYFKAVLYCEVWAMHERDAGAGTDATRQNAQLMDIMKTAHLAIGIDDAAK
AFIDPISCRSEYYLLERNYAQRLLHYDAASCSKGTFERSAYVDALKGTHLFGLANRMVER
TEVDFECAWRLADWSVALEDDAEDRVDWENMFEKQHYKALKCLELKDETASVAAVSEGRR
VLAEMLKVASMESTKNVYPFLCKLKLLQQIEDFMSVLFHRPVDGEKDLLQKWVQQDKLTY
SDFSFMELILSQRLAILKTAGIRAKRTWAPDAMHHAAFQLIHEARVTGHHDVAAANICAM
MNSQNLSENVKALVMLEDAQLNWAVGDKLLAKKLVNGIVAGGKCRDLLVNGAAYRIYGSF
LAETNVEDVKNLYDNFFKQSTALVDESLRQARSQPSNSFIDYQSKCLEGDKNYVVLHTVA
TYADREFIRLKNHSTSSDFKAKKANLERMKRELSMVEAELAKLKETERDKISHLRRARMS
TKQNIARDESSLKTMVFHMNEYLQMALLYYSSYARFTSIESDLAVFRFVGLWLGNHSDKI
EDTVTEGIKVIPTHKIVPVLPQLAPRLDNHTEGVGKIVRDILERCAIDHPHHTLPHIFAQ
LYAYADVERTEVPKDDERLLGAQALHGRLAKCEKIAETVQQMSEMNLAFIQMANKALGGG
AKGFGEYRMTAQDVLKKCRELDKVHCSTVELPVSEGGKYGNIIGEWIFCFFYLGI
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgagcgatgtgatcaagaccatttccgccgagtgtgttgcctttctcgttccc
aaatgggcaaattgcgccaacatgtcggcaaagtacaccgccaaagccagcgccatggag
cacgttctgggcaatcagctggatttgaagcggttcgtttccggtgaacagaacaatctg
cgcgttctcaaactactaacagcctgctgtcaggacgaaagtcggatggtcgaaatgttg
gaacgtgaggtgctgattcccagcgacgaacacgtgctgaccgtggaaaactacctcagc
tgcttgacccactaccaaagcttgatcaactccaagtactcgctcgtgacttatttctgc
atgaagcatccggccgtgatcgagcagcttctgctggatcttaagttgaaaatctaccgc
tcggaagttgtcgaagagaagataaaggttctgtttcagtactcgacggtgatcgatcag
ctggaggaatacttttgccagcaccgttccacccatttgaaagagttcctggcgcgcgat
atctgctacttcctgtgccacacgatggtgtcgtccaaagcgctgcacgttccggttcta
aactgcttgaaacgcttcctcgagaaggaactcccgacgtgtgcagaatatttccgaccg
tatttgaacttcctaacttcgtctctgctgtcggtgtacgatcacaacactaacgaaaag
gtggccctcaaaaccatccacgtgctaaggttgatcgtggttgatcatcaggcgatgttc
ggcgatgccatcggcaagctcaaccactttcccgaggacgaagcattcaaagagctgcga
caagccttgcaacagcacaaggagcagtcactgtacaagctaacactggccgaggacatt
acccggatgatacagctgccaagcctaaagtttgaagagttgaccacgatgcgttccatg
ttggcgtcgagaaaggacgagctgcgcgcgatctgcgaggaactgcaagcctcggacgga
ttctcggaaaactgctcacaaaacgcgctgctgcgcttgatcaacgtcctgatcaacgaa
atccgctccggttctaccgataagcacaggatcgaagcgctctgctgccttggggaaatc
ggacctgtcgatctgtcgacaatgctgcttcgttcggacgctcaacaggaaatctataaa
acttcaagcagcgctgaagaggccgaagaacacctggttcaagtaatgatcgtcgagctg
aaccaactggtcgtcagcaggaacgtactggttgctgaacaagctgcgatcgtgtgctgc
cacgtgttgcagatcggacggtatcgcgcgcttgcgaacaacctgcgaacgctggttccg
tacatggtgctggcggagagagatggtcggatatttggagctggccctagcgggaaattg
aacctgagcgacgcgttgaacgccgcaacgagctacgaatcgtttgtgcgagtgctggtg
ggcatgctgctggagttctttcaggacaaggcgctgaaatcgctggcggaggttgaggtc
gcattcgcagccaaattaatcccgttgctggtacagatcgttctgagtttgcacgacaaa
aacctcaacgatgatgttgggaatttcgtaaacacattcttcaccatgttcagcgacaac
accaacaacggttgtctcagtaaagatctggagacaattcacttgatgctgacgattgtg
gagtgtgttcggcttaacaatcaaagcaacccgcagcacaagattgacctcaactgtctc
accatagctggggcaagtttgcactgccacgcgtacttcaaggccgtcctgtactgtgag
gtgtgggcgatgcacgaacgtgatgccggtgctgggaccgacgcaacccgtcaaaacgcc
caactgatggacattatgaaaacggcgcacctggccatcggcattgatgacgcggcgaag
gcgttcattgatcctatcagctgccgcagtgagtattacctgctggagcggaactacgcc
cagcgattgctgcactatgatgcggccagctgcagcaagggaacgttcgagaggtcggct
tacgtggacgcgttgaagggaactcacctgtttgggttggccaacagaatggtcgagcgg
accgaggtcgactttgagtgtgcttggcggcttgcggactggagcgtggcgctggaggat
gacgccgaggacagggtcgattgggagaacatgtttgagaagcagcactacaaggcgctc
aagtgtttggagctgaaggacgaaactgccagcgttgccgctgtgtccgagggtagaaga
gtgctggcggaaatgctgaaggtggccagcatggagtccaccaagaacgtttacccgttc
ctgtgcaagttgaagttgttgcagcagattgaagactttatgagcgttctcttccaccgt
cccgttgacggggagaaagacttgctccagaaatgggttcagcaggacaagctaacctac
agtgacttctcctttatggagctgattttgtcccagcggctggccatactcaaaacagcg
ggaatccgcgctaaacgaacgtgggctccagatgcgatgcatcatgccgcgttccagttg
atacacgaagcacgcgtcacgggtcatcacgacgtggcggcggcgaatatttgcgccatg
atgaacagccagaacttgtccgagaacgtcaaggcgctggtaatgcttgaagatgcacag
ctcaactgggccgtaggcgacaaactgttggccaagaagctggtgaatggcatcgttgcc
ggtggaaaatgcagagatctgctggtgaatggtgccgcctatcgcatttacggaagtttt
ctcgccgaaacgaacgtcgaggacgtgaagaatctgtacgacaacttcttcaaacaatca
accgcactcgtggatgaatcgctgcgtcaggcaagatcgcaaccgtccaattccttcatc
gactaccagagcaagtgtctggaaggtgacaagaactacgtcgtgctgcacactgtcgct
acgtacgccgatcgtgagttcattcgactcaaaaaccactcgacttccagcgatttcaaa
gcgaagaaagccaatttggaacgcatgaaacgcgagctatcgatggtcgaagccgagctg
gccaaactcaaagaaaccgaaagggacaagatttcccacctgcgaagggccaggatgagc
acgaaacagaacattgcacgtgacgagtcttcgctgaaaacgatggtcttccacatgaac
gagtacctccagatggctctgctttactactcctcgtacgccaggttcaccagcatcgag
agtgacctcgccgtgttccgcttcgttgggctttggctaggaaaccacagcgacaaaatc
gaagacaccgtcaccgaaggtatcaaggtgatcccaacgcataagattgtgccagtgctg
ccacaactcgcgccccggctagacaaccacaccgaaggtgtgggaaaaatcgtacgggat
atcttggagcgatgcgcgattgatcatccgcaccacacgctgcctcacattttcgcccaa
ttgtacgcgtacgccgacgtcgagaggacagaagtgcccaaggacgacgagcggctgctg
ggagcgcaggcactgcacggtcggctggccaagtgcgagaaaatcgccgaaacggtgcag
cagatgagcgaaatgaacctggcgttcatccagatggcaaataaggcgctcggtggcggg
gccaaggggttcggcgagtaccggatgaccgcccaggacgtgctgaagaagtgccgcgag
ctggacaaggtgcactgctcgacggtcgagctgccggtcagcgagggcggcaagtacggc
aacattatcggtgagtggatattttgctttttttatttgggcatctaa

DBGET integrated database retrieval system