KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002200
Entry
CpipJ_CPIJ002200  CDS       T01079                                 

Definition
(GenBank) Bcl-2 associated protein
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ002200
   04215 Apoptosis - multiple species
    CpipJ_CPIJ002200
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-ProteinID: EDS34832
VectorBase: CPIJ002200
UniProt: B0W585
LinkDB
AA seq 275 aa
MANLEPVTGGPSRTLPEYERNPIIRHIKLHEIERYVNLRSCRCSLIHSGQSGTGYPEVAT
NTPEWFWQSCIVFLGKCLCGEYIRARLKRSGLLNRKILQRLRSTMEFVPPSCVVVRETFP
VLNGMGEELERMHPRLYTNVSRQISLEPWGELTEPDSVCYLLHVVAKDLFKTDITWGKVI
SLFAIAGGLAVDCVRQEHYDYLQQLIEGTTDVIEEDLSAWLVEKGGWLGLHDHVHPPQTE
ITFLGWMTITISTLLVIYLISVLLKHLGSNYLSKF
NT seq 828 nt   +upstreamnt  +downstreamnt
atggccaatctggagccggttaccggtggcccatcgaggacacttccggaatatgagaga
aaccctatcatccgacatatcaaacttcatgaaattgaaagatatgtcaatctacggtca
tgccgttgctcgctgatccattccggccaatctggaaccggttacccggaagtggccact
aacactccagagtggttctggcaatcgtgtattgtgtttttaggcaaatgtctctgcggc
gagtacatccgcgcccggctcaagcggtcgggccttctaaatcgcaagatcttgcagcgg
ctgcgcagtacgatggaattcgttccgcccagctgtgtggtcgtccgggagaccttcccg
gtgctgaacggaatgggcgaagagctggaacggatgcacccgcgcctttacacaaacgtg
agccggcagatctcgctcgaaccgtggggtgagctgaccgaaccggactccgtgtgctat
ctgctgcacgtggtggccaaagatctcttcaaaacggacatcacctggggcaaagtgatc
tcactgtttgccatcgctggagggctcgcggtggattgtgtccgccaggaacactacgac
tatctgcagcagctgatcgagggcaccacggacgtgatcgaggaagatctgagcgcatgg
ctggtggaaaagggcggctggctgggtctgcacgatcacgtccatccaccccaaaccgag
atcaccttcctcggctggatgaccatcaccatctcgacgttgctcgtcatttacttaatc
tcggttttacttaaacatctcggctcaaactatctgtcgaagttctag

DBGET integrated database retrieval system