KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002201
Entry
CpipJ_CPIJ002201  CDS       T01079                                 

Name
(GenBank) buffy
  KO
K20017  Bcl-2 family protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ002201
   04215 Apoptosis - multiple species
    CpipJ_CPIJ002201
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-ProteinID: EDS34833
VectorBase: CPIJ002201
UniProt: B0W586
LinkDB
AA seq 288 aa
MTAEPPPTTTTTASSNHNLNNNNLNHHHHLFPTDRLSAPVLARRKFSFPASFHSTVLHGD
HHPSGTLHSGSLQPTSTAASAARRRLSNVSDVVTRKLSSTIGWKQPVLPSQDIITQGKCL
CGQYIRCRLKKSGVFNRKLGLQRIRSIVGTPSIHVVREVFPALLSVGDELERMYPRVYTG
IARQLTRFGRGELKTPETAPVLLSAIARDLFKADITWGKVVSLFAIAGGLSVDCVRQGHP
DYLPKLIEGVADVIEDELVTWISENGGWVGLANKVRPPPEEITFAGRR
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaccgcagaaccaccgccgaccaccaccacaaccgcctcttcaaaccataacctcaac
aacaacaacctgaatcatcaccatcacctgtttccaacggatcgactcagcgctccggtt
ctagcgcgacgaaagttcagctttccggctagctttcactccaccgtcctccacggagac
caccacccctcggggacactccactcggggtcgctccaaccaacgagtacggcagcatcc
gcggcccggcgtcgactcagcaacgtcagcgatgtggtcacccgcaagttgtccagcacg
atcggctggaagcaaccggttctaccctcgcaggacatcatcacccagggcaagtgcctg
tgcggccagtacatccggtgtcggctgaaaaagtccggcgtgttcaaccggaagttgggt
ctgcaacggatccgcagcattgttggaacgccctcgattcacgtggtccgcgaggtgttc
ccagcgctgctaagtgtcggtgacgagctggagcggatgtacccccgcgtttacaccgga
atcgcccgccagttgacgcgctttggccgcggtgagctcaaaacgcccgaaacggcaccc
gtgctgctgagtgcgatcgcccgggacctgttcaaggcggacatcacctggggcaaggtc
gtgtcgctgtttgccattgccgggggcctctcggtcgactgtgtccgccagggccacccg
gactacctgccaaagctgatcgagggcgtggcggacgtcatcgaggacgagctggtcacg
tggatctcggagaatgggggttgggttggtctggcgaacaaggttcggccacctccggag
gagatcaccttcgcgggaagacgatag

DBGET integrated database retrieval system