KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002803
Entry
CpipJ_CPIJ002803  CDS       T01079                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02084  apoptotic protease-activating factor
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ002803
   04215 Apoptosis - multiple species
    CpipJ_CPIJ002803
SSDB
Motif
Pfam: ANAPC4_WD40 WD40_2 WD40_like WD40 DUF1828 TSC22
Other DBs
NCBI-ProteinID: EDS38854
VectorBase: CPIJ002803
UniProt: B0W8C5
LinkDB
AA seq 731 aa
MHMAGNVLVALDETGTINVWSLRNIPLDRNARQHESDGSLPIRRRIQTLVPHPSTDRFTG
FCIVSKIASSVDPAVILSEMFAITQNGTLYIFKGLTNFTESMKHNTNIKNIIIIKPLIDV
PGQNPKLLFVTSDNQGCIFNLKSTSVECRFSEPDIVNIHYMGNALVFVGENQIRLRKFSR
NERNQLQIEPAVVIYKTPTNHRNACSAISDDYEYIILGTTQGISIFSIREEVEVLRTNIS
QSILDVDIFPLDDAQYRYILISSSEDSGNVINMYSLMVTAQNQLVSNQYQLQDNAVYHAD
LEADPVTVKTVDRKRVIQEVMYTRLHQRDDFRLISPPIENKPLASVVKRLTQCTSGFYLG
LANGDVLRLEEWSNGSEDPEPEVVCNLGGAITLLKSFDEPQLLVAASDSRCKIFVAHDQV
VEMPEELCECYLYRDQHLVLLFDAGRVQIFNVQTKQFEFVIDAGNPYGASAINDQYLIVG
MTNGDILQYAIEQHDTLELHLVHTYVQPKRITSCALSANGELLAVGYKNGALEIYNTEER
KLISTLESHRCDVASLYFSPWKDSNNPQILVSVGEQIVFWSLDSVINNPDSRGDVKRRSN
RYKTRPSLTSPALDIHRTSFGSRSSGLSSPLAASPSRNGSFTFDLDEAAHQWLTKSGPSN
KPHLLSCIKLIGSAERLIVNRDFNKFFTIDDEGYIYYLRLFQPPSRHRLTATSFMSPAAV
ARLSNGTSFPF
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgcacatggccggaaatgtgctggtagcgctggacgaaacgggaacgatcaacgtgtgg
tcgttgagaaacattccgttggatcgcaacgctcgacagcacgaaagcgatggcagcctg
ccgatccggcgtcgcattcagaccttggtgccgcacccttcgacggatcggttcaccggg
ttctgcatcgtttcaaagatagcatcttcggtggatccggccgtgattctgtcagaaatg
tttgccataacccagaacggaaccctgtacatcttcaaagggttgaccaactttacggaa
tctatgaagcacaatacaaacattaagaacatcatcatcatcaaaccgttaattgacgtt
cccggccaaaatccgaagctactcttcgttaccagcgacaaccagggatgcatctttaac
ttgaagtccaccagtgtcgagtgccggttcagcgagcccgacatcgtgaacattcactac
atgggcaatgcgctggtgtttgtgggtgaaaaccagatccggttgcgcaagttcagccgt
aacgaacgcaatcagctgcaaatcgaaccggcggtcgtcatctacaaaactccaaccaat
caccgcaacgcctgcagtgccatctcagacgactacgagtacatcatcctgggtacgacc
caagggatatcgatcttcagtattagagaggaggttgaggtgctgcggaccaacatcagc
cagagcatcctggacgtggacatcttcccgctggacgacgctcaatatcggtacattctg
atttcctcttccgaggacagcggcaacgtgatcaacatgtactcgctgatggtaacggca
cagaatcagctggtcagcaaccagtaccaactgcaggacaacgccgtctaccatgccgat
ctggaggcggatcctgtcaccgtgaagaccgtggatcgcaagcgtgtcattcaggaggtc
atgtacacaaggcttcaccagcgcgacgattttcgcctgatttcacccccgatcgaaaac
aaaccgctggctagtgttgtcaagcggttgacacagtgcacatccgggttctatctgggt
cttgccaacggtgacgtgctgcggctggaggaatggagtaacggaagcgaagacccggaa
ccggaagtggtttgcaacttgggcggcgcgatcactctactgaagagctttgacgaacca
cagcttctggtggcggcttccgacagccgttgcaagatctttgtcgcacacgatcaagtg
gtcgagatgccggaagagctgtgcgagtgctacctttaccgggaccaacatctggtgctg
ctcttcgacgctggccgtgttcagatattcaacgtacaaaccaaacagttcgagttcgtg
atcgatgctggcaacccgtacggtgcatcggccatcaacgaccaatacctaatcgtaggt
atgacaaacggcgatatcctacagtacgcgatcgagcagcacgatacgcttgaactccac
ctggtgcacacctacgtacaaccgaagcgaatcaccagctgcgctctgtccgccaacggt
gagctgctcgcggtcggctacaaaaacggagccctcgaaatctacaacaccgaggaacgc
aaactcatctccaccctcgaatctcaccgctgcgacgtggcctctctctacttcagccct
tggaaagattccaacaacccgcagatactggtcagcgtcggcgagcagatcgtcttctgg
agtctggactctgtaatcaacaaccccgactccagaggcgatgtcaagcgacgctcgaat
cgctacaaaacgcgaccatccctaacctctccagcgctcgacatccaccgaacctccttc
ggcagccgctcgtccggtctctcgtccccgctcgccgccagcccctcccgcaacggttcg
ttcacgttcgacctggacgaagccgcccaccagtggctcaccaagtccggaccctccaac
aaaccccacctgctgtcctgcatcaagctgatcggcagcgccgaacggctcatcgtcaac
cgggactttaacaagttcttcaccatcgacgacgagggctacatctactacctgcgactg
ttccaaccaccgagccggcaccgactcaccgcgaccagcttcatgtcgccggccgccgtg
gcccgcctctcgaatggcacctccttccccttctga

DBGET integrated database retrieval system