KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002923
Entry
CpipJ_CPIJ002923  CDS       T01079                                 

Definition
(GenBank) caspase-1
  KO
K20009  caspase Dronc [EC:3.4.22.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ002923
   04215 Apoptosis - multiple species
    CpipJ_CPIJ002923
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ002923
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     CpipJ_CPIJ002923
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ002923
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-ProteinID: EDS37662
VectorBase: CPIJ002923
UniProt: B0W757
LinkDB
AA seq 417 aa
MNQLERHRILRNMDQLIQNTNYEVLKKECYLRRMLSEVMIAVIEDRYRDEASKHKKLFEK
ITKRGPTAFQTLLEICQGNFPAAYKLLKGGPVVGFNQNQNLNVGGQHETFNSTFHPNRRR
AVSANFGESSQLAVQQQRLERLSIGSRSISAEDEDAKNNNQEIETTDGKMRLVEYLEPVQ
DLLKVKLTTRPQRPRLLEVYPMTSTRRGLGFTVFYYEDLTNGDFQLLVKELKNSPHLSAE
CFAFYILAHGNHNKGWDKIYLNDNSILFVHDILKLFNNENCPKLIGRPKLFFFSICRGDR
ADFGQYRSDANTERDGMINRNKEPPTNMPTYADMYICFSTVPGFSAHRDTSLGSWLVESM
CKVWAEHAHDTDVEQLMKLVGKEMARYRTENLGMQTLACEQYGFYDLLYLNPGYSVE
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaaccagctggaacggcatcggattttgcggaacatggatcagctgattcagaacacc
aactacgaagtcctgaagaaagaatgctacctgcgacggatgctgtccgaggtgatgatt
gccgtcattgaggatcgctaccgggacgaggcctcaaagcataagaagctgtttgagaag
attaccaaacgagggccgacggcgttccagacgttgctggaaatttgccagggcaacttt
ccggctgcttataaattgctcaaaggtggaccggtggtgggattcaaccagaaccagaac
ctcaacgtcggtggtcagcatgagacctttaactctacgttccatccgaaccgacgtcgt
gcggttagcgccaactttggagagtccagccagttggccgtccagcagcagaggctggag
cgtttatcgattggttcgcggtcgatttcggccgaagatgaggacgccaagaataacaac
caggagattgagacaacggatggaaagatgcgcctggtggagtacctggagccggttcag
gatctgttgaaggtgaaactgaccacgcgaccgcagagacctcgactgctggaggtgtat
ccgatgacgtcgaccagaaggggtctagggttcacagtattttactacgaggatctgaca
aacggagacttccagttgctggtgaaggagctgaagaattccccacacctctcggccgaa
tgcttcgcgttttacattctagcccacggcaaccacaacaagggttgggacaagatttac
ctcaacgacaactcgatcctgttcgtgcacgacatcctgaagctgttcaataacgaaaac
tgccccaagctgatcggccgaccgaagctgttcttcttctcgatctgcaggggtgaccga
gccgactttggccagtaccggtcggacgccaacacggagcgcgacggcatgatcaaccgg
aacaaggaaccgccgacgaacatgccaacatacgccgacatgtacatctgcttttcgacg
gtgcccggattttcggcccaccgggacaccagcctcgggtcttggctggtggagagcatg
tgcaaggtttgggccgaacacgcccacgacaccgacgtcgagcagctgatgaagttggtc
ggcaaggagatggctcggtaccgcaccgaaaacctcggcatgcagacgctggcctgcgag
cagtatgggttttacgacttgctgtacctcaacccggggtacagtgtggagtga

DBGET integrated database retrieval system