KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005160
Entry
CpipJ_CPIJ005160  CDS       T01079                                 

Definition
(GenBank) serine protease htra2
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ005160
   04215 Apoptosis - multiple species
    CpipJ_CPIJ005160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ005160
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cqu03110]
    CpipJ_CPIJ005160
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     CpipJ_CPIJ005160
Peptidases and inhibitors [BR:cqu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   CpipJ_CPIJ005160
Chaperones and folding catalysts [BR:cqu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   CpipJ_CPIJ005160
SSDB
Motif
Pfam: Trypsin_2 Trypsin Peptidase_S46 LSM
Other DBs
NCBI-ProteinID: EDS45136
VectorBase: CPIJ005160
UniProt: B0WE06
LinkDB
AA seq 375 aa
MQAISRAVINLRPARTINRFAVADRSIKTSASASYISWNRRGQGQDHRQRQHSTGSVLGT
AALSGLISGLFLRTAEEDHDRQDRRKFSLFPSVSAATTFKDLKGRRAMHNFIADVVDVSA
PAVVYIEIKDTRHYDFFSGQPVTISNGSGFIVEEDGLILTNAHVVISKPNAMVTVKLLDG
RTFPGTVEDVDPNSDLATVRIKCKSLPVMKLGKSSDLRSGEWVVALGSPLALNNTVTAGV
VSSTQRASQELGLRGKDINYIQTDAAITFGNSGGPLVNLDGEAIGINSMKVTPGISFAIP
IDHAREFLLKGADRRKAKGFSTEKIPVRRYMGITMLTLTAEILRELRQRSHNVPDSVRNG
ILVWKVIQGSPAHVF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcaagcgataagccgtgccgtaattaatctccgtccagccagaactatcaaccgattt
gcagtagctgacagaagtatcaaaacaagcgcaagtgctagttacatcagctggaaccga
agaggacaaggtcaggaccatcgtcaacggcaacacagcaccggttcggtgctcggtaca
gctgccctgtccggtttgatcagtggcctctttctacgtacagccgaagaagatcatgac
cgtcaagatcgccgcaagttctcgctcttccccagcgtatccgccgcgaccaccttcaag
gacctcaaagggcgccgagcgatgcacaatttcatagcggacgtcgtagacgtgtcggcc
cccgctgtggtctacatcgaaatcaaagacacccgccactacgacttcttctccggccaa
ccggttacgatctccaacgggtccggcttcatcgtcgaggaggacggcctcatcctgaca
aacgcccacgtcgtcatcagcaaaccgaacgcgatggtgacggtcaagctgctcgatggg
cgaacgttccccggaaccgtcgaggacgtcgaccccaactcggacctcgccaccgtacgc
atcaagtgcaaaagcctccccgtcatgaagctcggcaaatcgtcggacctacgctcggga
gagtgggtggtcgccctggggagtcccctggcgctgaacaacacggtcaccgccggtgtc
gtaagttccacgcaacgtgcttcgcaggagctcggactgcgcggcaaggacatcaactac
attcaaacggacgcggcgatcacgtttggaaattccggaggtccgctggtcaacctggac
ggagaggccatcggaatcaacagcatgaaggtgacgcccggaataagttttgcgatcccg
attgatcacgcgagggagtttttgctgaagggggccgatcggaggaaggcgaagggattt
agcaccgagaagataccggtgcggaggtacatgggaattacgatgctaacgctgacggcg
gagattttgcgtgagttgaggcagcggagtcacaacgtgccggatagcgtgaggaacggg
attctggtgtggaaggtgatacagggatcgccggcgcatgttttttaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019291
Entry
CpipJ_CPIJ019291  CDS       T01079                                 

Definition
(GenBank) serine protease htra2
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ019291
   04215 Apoptosis - multiple species
    CpipJ_CPIJ019291
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ019291
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cqu03110]
    CpipJ_CPIJ019291
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     CpipJ_CPIJ019291
Peptidases and inhibitors [BR:cqu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   CpipJ_CPIJ019291
Chaperones and folding catalysts [BR:cqu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   CpipJ_CPIJ019291
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 Peptidase_S46 Tricorn_PDZ PDZ LSM
Other DBs
NCBI-ProteinID: EDS30374
VectorBase: CPIJ019291
UniProt: B0XJH1
LinkDB
AA seq 394 aa
MQAISRAVINLRPARTINRLAVADRSIKTSASASYISWNRRGQGQDHRQRQHSTGSVLGT
AALSGLISGLFLRTAEEDHDRQDRRKFSLFPSVSAATNFKDLKGRRAMHNFIADVVDVSA
PAVVYIEIKDTRHYDFFSGQPVTISNGSGFIVEEDGLILTNAHVVISKPNAMVTVKLLDG
RTFPGTVEDVDPNSDLATVRIKCKSLPVMKLGKSSDLRSGEWVVALGSPLALNNTVTAGV
VSSTQRASQELGLRGKDINYIQTDAAITFGNSGGPLVNLDGEAIGINSMKVTPGISFAIP
IDHAREFLLKGADRRKAKGFSTEKIPVRRYMGITMLTGGLYPGDIITSINGHEVKNSGDV
YELLSAKERELNITIYRGVDRMTVKVTPEDADAI
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcaagcgataagccgtgccgtaattaatctccgtccagccagaactatcaaccgactt
gcagtagctgacagaagcatcaaaacaagcgcaagtgcaagttacatcagctggaaccga
agaggacaaggtcaggaccatcgtcaacggcaacacagcaccggttcggtgctcggtaca
gctgccctgtccggtttgatcagtggcctctttctacgtacagccgaagaagatcatgac
cgtcaagatcgccgcaagttctcgctcttccccagcgtatccgccgcgaccaacttcaag
gacctcaaagggcgccgggcgatgcacaatttcatagcggacgtcgtagacgtgtcggcc
cccgctgtggtctacatcgaaatcaaagacacccgccactacgacttcttctccggccaa
ccggttacgatctccaacgggtccgggttcatcgtcgaggaggacggcctcatcctgacc
aacgcccacgtcgtcatcagcaaaccgaacgcgatggtgacggtcaagctgctcgatggg
cgaaccttccccggaaccgttgaggacgtcgaccccaactcggacctcgccaccgtacgc
atcaagtgcaaaagcctccccgtcatgaagctcggcaaatcttcggacctacgctcggga
gagtgggtggtcgccctggggagtcccctggcgctgaacaatacggtcaccgccggtgtc
gtaagttcgacgcaacgtgcttcgcaggagctcggactgcgcggcaaggacatcaactac
atccaaaccgacgcggcgatcacgtttggaaattccggaggtccgctggtcaacctggac
ggagaggccatcggaatcaacagcatgaaggtgacgcctggaataagttttgcgatcccg
attgatcacgcgagggagtttttgctgaagggggccgatcggaggaaggcgaagggattt
agcaccgagaagataccggtgcggaggtacatgggaattacgatgctgaccggcggcctc
tacccgggcgacatcatcaccagcatcaacgggcacgaggtcaagaactccggcgacgtg
tacgaactgctgtcggcaaaggagcgcgaactgaacatcaccatctaccggggcgtggat
cgcatgacggtcaaggtcacgccggaggacgcggatgcaatttaa

DBGET integrated database retrieval system