KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006019Help
Entry
CpipJ_CPIJ006019  CDS       T01079                                 

Definition
(RefSeq) trypsin 5G1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    CpipJ_CPIJ006019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cqu01002]
    CpipJ_CPIJ006019
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ006019
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     CpipJ_CPIJ006019
Peptidases [BR:cqu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   CpipJ_CPIJ006019
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ006019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6037450
NCBI-ProteinID: XP_001847362
VectorBase: CPIJ006019
UniProt: B0WF77
LinkDB All DBs
AA seq 264 aa AA seqDB search
MNQFITLLATAVACVALVQGASTARHPARPWWNAPPSSERIVGGFEIDILEVPYQISLQS
YGHFCGGSIIGANWVLTAGHCASDYDVGLHVRVGSSLHGSGGQLVSVKRVIQHPQYNPNT
IDYDFALLELEQPVQLSEEFFAVELPEQDQEVEDGQLLQVSGWGYTQNPSESNEALRATN
VPAVSQEECRESYGTNQITDRMICAGYQAGGKDACQGDSGGPLVEGKTLVGVVSWGIGCA
EPGYPGVYSRVAAVRDWIKEHSGI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttcatcacccttctggccaccgccgttgcctgcgttgccctggtccagggt
gcctccaccgcgcgccatccggcccgtccctggtggaacgcccctcccagcagcgaacgc
atcgtcggtgggttcgagatcgacatcctggaggttccgtaccagatctcgctgcagtcc
tacggccacttctgcggtggatcaatcatcggtgcaaactgggtcctaaccgccgggcac
tgcgctagtgattacgacgttggactgcacgtccgcgttggatcatcgctgcacgggtcc
ggaggtcagctggtttcggtcaagcgggtcatccagcatccccagtacaacccgaacacc
atcgactacgattttgccctgctggagttggagcagccggttcagctgagcgaggagttc
tttgccgttgagcttccggagcaggatcaggaggttgaggatggtcagctgctgcaggtt
tccggctggggttacacccagaacccgtccgagtctaacgaggcgctgcgtgctaccaac
gtcccggcagtcagccaggaggaatgccgtgagtcgtatggaaccaaccagattaccgat
cgtatgatttgcgctggataccaggccggtggtaaggacgcttgccagggagactccggt
ggtccgctggttgaaggaaagaccctggttggagtcgtttcgtggggtatcggttgtgcc
gaaccgggatatccgggagtgtactcccgtgtggccgctgttcgtgactggatcaaggag
cacagtggaatttaa

DBGET integrated database retrieval system