KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006167Help
Entry
CpipJ_CPIJ006167  CDS       T01079                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00020  Citrate cycle (TCA cycle)
cqu00190  Oxidative phosphorylation
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
Module
cqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cqu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpipJ_CPIJ006167
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CpipJ_CPIJ006167
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CpipJ_CPIJ006167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like FAD_binding_3 AATF-Che1
Motif
Other DBs
NCBI-GeneID: 6037731
NCBI-ProteinID: XP_001847611
VectorBase: CPIJ006167
UniProt: B0WFX7
LinkDB All DBs
AA seq 661 aa AA seqDB search
MAYGDGLRGSEADSVCANSTRGLAAPSAQRGVHFTVGQNNAKSNADAISKEYPVVDHTYD
AVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFAMDLLMENGQCVGVIALNLEDGS
IHRFRSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGLPSEDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDH
VYLQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLT
VDASGNDHVVPGLYACGESACSSVHGANRLGANSLLDLVVFGRACAKTIAAEHRPGEKIA
DIKSNAGEESVANLDWVRNANGAIPTSELRLNMQKTMQTHAAVFREEKTLQEGVRKMGEI
YKTIKDVKVSDRSLVWNSDLVETLELQNLLLNANMTITAAENRKESRGAHAREDYKTRVD
EYDYSKPLEGQQKKPVEEHWRKHTLTWIDPATGAVKIDYRPVIDQTLSEECNTVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcctacggcgatggcttgcgcggttccgaggcagactcggtttgcgccaactcgact
cgtggcctggcggcgccttccgcccagcggggagtgcatttcaccgtgggccagaacaac
gccaagtcgaacgcggacgccatctcgaaggagtacccggtggtggaccacacgtacgat
gccgtcgtggtcggtgccggtggagcgggtctccgggctgcgttcggtctggtggccgag
ggcttcaagacggccgtcatcacgaagctgttcccgacgcgttcgcacaccgttgcggcc
cagggcggaatcaacgccgcgctaggcaacatggaggaggacgactggaagtggcacatg
tacgacacggtgaagggatccgattggcttggggatcaggatgcgattcactacatgacg
agggaggcaccgaaggccgtcattgagttggagaactatggaatgcccttctcgcgtact
ccggacggcaagatctaccagcgtgcatttggtggtcagagtttaaagtttggcaagggt
ggtcaggcgcatcgatgctgttgcgttgcggatcgtaccggccattcgctgctgcacacg
ctgtacggccagtcgctgagctacgattgcaactactttattgagtactttgcgatggat
ctgctgatggagaatggccagtgcgtgggcgtgattgcgctgaacctggaggacggtagc
attcatcgcttccggtcgaagaatactgtgctggctacgggaggttacggtcgtgcgtac
ttctcgtgcacatcggcgcacacctgtaccggagacggaactgcgatggttgcccgtgct
ggactgccctcggaggacttggagtttgtgcagttccacccgacgggaatttacggtgcc
ggttgtctgatcaccgagggatgccgaggagagggcggttacctgatcaactctcagggt
gaacgcttcatggagcgatatgcaccggtggcgaaggatttggcctcccgtgatgtcgtg
tcccgttcgatgaccatcgaaatccgcgagggtcgcggttgtggccctgagaaggatcac
gtttacctgcagctgcaccatctgcccccagagcagctggcccagcgtctgcccggaatt
tccgaaaccgctatgatctttgccggcgttgatgtgacccgcgaacctattccagtgctg
ccaactgtccattataacatgggcggcgttccaactaactacaagggccaggtgttgacc
gtcgacgccagcggcaacgaccatgtcgtgcccggactgtacgcttgcggagaatcagcc
tgctcgtcggttcacggtgctaaccgcctcggagccaactcgctgctggatttggtcgtg
tttggccgtgcctgcgccaagaccatcgctgctgaacatcgcccgggtgagaaaatcgcc
gacatcaagtcgaacgccggcgaagagtccgtcgcgaacctggactgggtgcgcaatgca
aacggtgccattcctacctcagagctgcgactcaacatgcaaaagaccatgcagacgcat
gccgccgtgttccgcgaggagaagaccctgcaagagggcgtccgcaaaatgggcgaaatc
tacaagacgatcaaggacgtcaaggtgtccgatcggtcgctggtgtggaactcggacctg
gtcgaaacgctggagctgcagaacctgctgctgaacgccaacatgaccatcaccgccgcc
gaaaatcgaaaggagtcacgtggtgcccatgctcgcgaggactacaagacccgcgtcgac
gaatacgactacagcaagcccctggagggccagcagaagaagcccgtcgaggagcactgg
cgcaagcacaccctcacctggatcgacccggccaccggcgccgtcaagatcgactaccgc
ccggtcatcgaccaaaccctcagcgaggagtgcaacacggttccgccggcgatccgctcg
tactaa

DBGET integrated database retrieval system