KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006694
Entry
CpipJ_CPIJ006694  CDS       T01079                                 

Definition
(GenBank) survivin
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ006694
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ006694
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ006694
Peptidases and inhibitors [BR:cqu01002]
 Peptidase inhibitors
  Family I32: IAP family
   CpipJ_CPIJ006694
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     CpipJ_CPIJ006694
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    CpipJ_CPIJ006694
SSDB
Motif
Pfam: BIR RNA_pol_N
Other DBs
NCBI-ProteinID: EDS27935
VectorBase: CPIJ006694
UniProt: B0WHR8
LinkDB
AA seq 141 aa
MVSTENIEKVFLLETDRVKSFKKWPYSGTSSCSIQKMAEAGFYWNGNDNEEDTAACFVCG
KVLDGWEETDAPWEEHKKHAPQCPFVKFGRAEAELTVEEMIDLLEAIMKARLQNGYNTMK
DGLKACIEKKRKEMLKQLGKN
NT seq 426 nt   +upstreamnt  +downstreamnt
atggtttcgacggaaaacatcgaaaaagtgttcctcctggaaacggaccgcgtcaaaagc
tttaagaaatggccctactccggaaccagttcctgtagcattcagaagatggccgaagcg
ggcttctactggaacggcaacgacaacgaggaggacacggccgcctgcttcgtgtgcggg
aaggtcctcgacgggtgggaggaaacggacgcaccctgggaggagcacaaaaagcacgcc
ccccagtgtccgttcgtgaagtttggccgggccgaggcggaactgacggtggaggagatg
attgacctgctggaggcgatcatgaaggcgcgcctccaaaacggttacaacacgatgaag
gacgggctgaaggcgtgcatcgagaagaagcggaaagaaatgctgaagcagctgggcaag
aactag

DBGET integrated database retrieval system