KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008049Help
Entry
CpipJ_CPIJ008049  CDS       T01079                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00010  Glycolysis / Gluconeogenesis
cqu00051  Fructose and mannose metabolism
cqu00052  Galactose metabolism
cqu00500  Starch and sucrose metabolism
cqu00520  Amino sugar and nucleotide sugar metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
Module
cqu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cqu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ008049
   00051 Fructose and mannose metabolism
    CpipJ_CPIJ008049
   00052 Galactose metabolism
    CpipJ_CPIJ008049
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ008049
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ008049
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CpipJ_CPIJ008049
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CpipJ_CPIJ008049
Membrane trafficking [BR:cqu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CpipJ_CPIJ008049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 6040777
NCBI-ProteinID: XP_001850122
VectorBase: CPIJ008049
UniProt: B0WN38
LinkDB All DBs
AA seq 449 aa AA seqDB search
MSTSEKIREQCQELILTDKQMEEIMRRVLKEINNGLHKETQPTADVKCFITYVQDLPNGK
EKGKFLALDLGGTNFRVLLIHLKDENDFEMLSKIYAIPQSIMLGSGTQLFDHIAECLANF
MKEHAVYDEKLPLGFTFSFPLTQLGLTKGMLARWTKGFNCSGVVGEDVVQLLKDAIARRG
DVQIEICAILNDTTGTLMSCAWKNHNCRIGLIVGTGSNACYVEKVENCEMFDGYKDPNKQ
HVLINTEWGAFGDNGALDFVRTEYDREIDHFSINKGRQIQEKMISGMYMGELARLAIVKF
TKAGLLFGGVGSDILFKRGQFFTKYVSEIESDKPGTYSYCRDVLDELGLEHATDEDCANV
RYICECVSSRAAHLVSAGIAALINKMDEKSVTVGVDGSVYRFHPKFHDLMVQKIRQFVKP
DISFDLMLSEDGSGRGAALVAAVACREAH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttcagaaaagatccgtgaacaatgccaggagctgattctgacagacaaacag
atggaggagatcatgcggcgggtgctgaaggagatcaacaacggtctccacaaagagaca
cagccgacggcggacgtcaagtgtttcatcacctacgtgcaggacctgccgaacggcaaa
gaaaagggcaaattcctcgcgctcgatctgggcggtaccaacttccgagtactgctgatc
cacctcaaggacgagaacgacttcgagatgctgtcgaaaatctacgccattccacagagt
attatgcttggcagtgggacgcaactgtttgaccacattgcggagtgtttagccaacttt
atgaaggaacatgcagtgtacgatgaaaaactacctctaggcttcacattctcattcccg
ctgacgcagctcggtctgaccaagggcatgctggcccggtggaccaagggtttcaactgc
tccggtgtcgtcggcgaggacgtcgtccagctgctgaaggatgccattgccaggcgaggg
gatgttcaaatcgaaatctgtgccattctcaacgataccacgggtacgctgatgtcctgt
gcgtggaagaaccacaactgtagaatcggactgatcgtcggcaccggcagcaacgcgtgc
tacgtcgagaaggtcgagaactgcgaaatgttcgacggctacaaggacccgaacaaacag
cacgtcctgatcaacaccgagtggggcgcgttcggcgataacggcgcgctcgactttgtc
cggacagagtacgaccgggagatcgatcacttcagtataaacaagggcagacagatacaa
gagaagatgatctccggaatgtacatgggcgagctggctcgcctggccatcgtcaagttc
accaaggccggcctgctgttcggtggcgtcggttccgacatcctgttcaagcggggccag
ttcttcaccaagtacgtgtcagaaatcgagtccgacaagcccggaacgtacagctactgc
cgcgacgtgctcgacgagttgggcctggagcacgccaccgacgaggactgcgcgaacgtg
cgctacatctgcgagtgcgtgtcgagccgggccgcccacctcgtgtccgccggtatcgcc
gccctcatcaacaagatggacgagaagagtgtgacggtcggcgttgacggctcggtgtat
cgtttccacccgaaattccacgatctgatggtgcaaaagatcagacagtttgtgaagccc
gacatcagcttcgacctgatgctgtccgaggacggttccgggcgcggagcagcactcgtg
gccgcggtggcgtgtagagaagcccactag

DBGET integrated database retrieval system