KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008808Help
Entry
CpipJ_CPIJ008808  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00562  Inositol phosphate metabolism
cqu01100  Metabolic pathways
cqu04068  FoxO signaling pathway
cqu04070  Phosphatidylinositol signaling system
cqu04140  Autophagy - animal
cqu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ008808
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    CpipJ_CPIJ008808
   04070 Phosphatidylinositol signaling system
    CpipJ_CPIJ008808
   04150 mTOR signaling pathway
    CpipJ_CPIJ008808
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ008808
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqu01009]
    CpipJ_CPIJ008808
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CpipJ_CPIJ008808
    3.1.3.48  protein-tyrosine-phosphatase
     CpipJ_CPIJ008808
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     CpipJ_CPIJ008808
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    CpipJ_CPIJ008808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase DSPn Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 6041063
NCBI-ProteinID: XP_001850374
VectorBase: CPIJ008808
UniProt: B0WNU0
LinkDB All DBs
AA seq 1334 aa AA seqDB search
MQVVSIFNMQICLCVIGNDLDDRDRLGSGAGPGQYYSVYPFKDHNPPDIELITSFCRDVD
EHLRANGKNVVAVHCKAGKGRTGTMICCYLLYSRQFQTADEALHYYAQRRTSDAKGVTIP
SQRRYVEYYATLLRSNETYQPVQLYICEIRLTGTVNIREGTINVSGETPKPLPEFRRTDD
TGGGGGGLVGGQSPPYTMLAKMDYCMPLSGDVKIEFVKSSVLRKEKRCHFWFNTYFVERA
AKKDAEGNLLLTLSKTEIDDAHKDKHHKEYPNNFSVELVLRRVPNGSKYSESVSLKKCHP
PPMHQQHHQQQHPLHPVGLAMTNNSSPLIRSSLENNRQVPPPHHQQPPPLSYQHHIAQQQ
QQQQQQYQQSIHRSQVGGDPYRAAMIKQQNSYNEGGGGGYLGQQPLQNNHNQQQQQLQHH
LEYSGTSSSESSTEEEGWDSGECPTQLLESPAKAANLLYYRNDNYYYGSCSSSSPTSSGP
SSSASHPNPTATTTTTAISTVSCNSSSSSVSKIREPSVAESASNSSSSGKLSHNAVSSSN
LNQPLANTTTISSSSSSSRSSIKPAVVVPEPFKPPRASNGKLPVEPLTAVACPSTSSANA
NASAWPSIGLRRKKKKSFKSTSARNFALATSASVASASTKSGKGRFRSFRWLKNMRGDPN
LKKVLATSGDIVTLTNAGRPVEEPDPTIPSTPPPSPTINALIVNATERFLSSSGENLLSL
DYYSSICDKQLSFESPCKSPGYLMKLNLSRRPPAPPPSEPDCPVVVAKPSEQRLKIGFDV
TPSPSPTSPQSDNPFVVVTTSEPDPQLLNPLPPTTSKAHNLVPRSENASFCDRILQTFVA
GISPRKSSAEHDLQVPPLPASSSSTHNSPLVARAVSRCSSFSLRELGQELRSVIKAQPAA
SAKPPASNPEEPPKKDSCRESRAAESNSPVARSLPRSQRARRTAIRQHQHHHHRHHHAHH
HNLHQQPSGDYPVPASGSNRTQPVPSVASSSSPASSPIKKSASAVESAVTSAASKLNSKL
RRMSTNAIFSFSTHNSNHTTSNTNCKSNNKPSTSDGVSVSVSNKCDIFNRGSAASRSSNP
ASPAKQVVRSVSNDPQILAGASHVAAPPSEGAPATVSPRRDSLPIIGSLLSSFSSSSVSS
SNSSSLSSSTFGTGSCSNSHVATTGAAHVGPPKTASRKLQSLFSVSSCYNGGASLSARDD
DDDDGDGDTPIVSIRNVAVAAAAAKKAAGNAVGVGDDGVGYLVLNSPESLVRYRLLSEPE
IVNLLVTNGTTASAPSSPPGHRHEADADEDEEDDDGGSSSCQSPPSSSAGVAGQTNASTN
ASTNTSANSSLVQA
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtatcaatatttaacatgcaaatctgcctttgcgtgattggcaacgatttg
gacgaccgggacagactcgggtccggagccgggccaggtcagtactactcggtgtacccc
ttcaaggaccacaacccaccggacatcgagctgatcacgtcgttctgccgggacgtggac
gagcacctgcgggccaacggcaaaaacgtggtggccgtccactgtaaagccggcaagggc
cggacaggcaccatgatctgctgctacctgctgtacagccggcagttccagacggcggac
gaggcgctccactattacgcacagcgacgcacaagcgacgccaagggcgtcaccattccg
tcccagcggcggtacgttgagtactacgccacgctgctgaggagcaacgaaacctaccag
ccggtgcagctttacatctgcgagatccggctcacggggacggtcaacatccgggagggc
acgatcaacgtgtccggcgagacgcccaagccgctgcccgagttccggcggacggacgac
accgggggtggtggaggtggtctggttggcgggcaatcgccgccgtacacgatgctggcc
aagatggactactgcatgccgctgtccggtgacgtgaagatcgagttcgtcaagagttcg
gtgctacggaaggagaaacggtgccacttttggttcaacacgtactttgtggagcgagcc
gccaagaaagacgccgaaggaaacctcttgctaacgcttagcaaaacggaaatcgacgac
gctcacaaggacaagcaccacaaggagtaccctaacaacttttcggtcgaactcgtgctc
cggagggtaccgaacggcagcaaatattcggagagtgtgagtctgaaaaaatgccatcca
ccaccgatgcaccagcagcatcatcagcagcagcacccgctccacccggtgggcctcgcc
atgaccaacaacagttccccgctcatccggtccagcttggagaacaaccggcaagtccca
ccgccgcaccaccaacagcctcccccgttgtcctatcagcaccacattgcccagcagcaa
cagcagcagcagcagcagtaccaacagtcgattcaccggtcgcaagttggcggtgatccg
taccgggcggcgatgatcaagcagcaaaacagctacaacgagggcggtggcggtggttat
ttggggcagcaaccgttgcagaacaatcacaaccagcagcagcagcagcttcagcaccac
ctggagtactcgggcacgtccagctcggagtcgtcgacggaggaggaaggatgggattcc
ggtgagtgtccaacgcaactactagaatcgcctgcgaaagcggcaaacttgttatattat
cgaaacgataactattactacggtagctgtagtagcagcagtcccacctcctccggcccc
tcctcgtccgcatcacatcccaatcccaccgctacaaccaccacaaccgcaatctccacg
gtcagctgtaacagtagtagtagtagtgtcagtaagatccgtgaaccgagcgtcgcggaa
agtgctagtaacagtagcagtagtggtaaacttagtcataatgctgtcagtagttcaaac
ttaaaccaaccattagctaatacaacaaccatcagcagcagcagcagcagtagtagaagt
agcattaagcctgccgtagtagtgcctgaaccctttaaacctccccgtgcaagcaacggc
aagcttcccgtagaaccgctaacagccgttgcttgtccctctacctcttctgctaacgct
aacgcctccgcttggccctctatcgggttgcgacggaagaagaagaaatccttcaaatcg
acttccgcgcgaaactttgccctggccacgagcgcttccgtcgcttcagcttccaccaaa
tccggcaagggtcgcttccgttcgttccgctggcttaagaacatgcgcggcgatcctaac
ctcaaaaaggtcctcgcaaccagcggtgacatcgtgacgctcacgaacgccggccgaccc
gttgaggaacccgatccgactattccgtcgacgccccctcccagcccgacgataaacgcc
ctcatcgtaaacgccactgaacggttcctctcctcgtccggcgaaaatcttctctcattg
gactattactcgtcaatttgtgataaacagcttagcttcgagtccccgtgcaaaagccca
ggatatctgatgaagctgaatctctcccggcggccccccgctcctcccccctccgaaccc
gactgtcccgtcgtggtcgccaagcccagcgagcaacggctcaaaatcggcttcgacgtg
acaccctcccccagccccaccagtccgcagtcagacaacccgttcgtcgtcgtaacgacc
agcgagccggacccgcaactcctcaacccgcttccccccaccaccagcaaagcccacaac
ctggttccgcgctccgaaaatgccagcttctgcgaccgcatcttgcaaacgttcgtcgcc
ggcatcagcccccgcaagtcttccgccgaacacgacctccaagtcccaccgcttcccgcc
agctccagcagtactcacaacagcccgctggtggcccgggccgtcagccgttgctcgtcg
ttttcgctgcgcgagcttggccaggagctgcgatcggtcatcaaggcgcaacccgcggcc
tcggccaaacctccggcatccaacccggaagaacctccgaagaaggactcttgccgcgag
tcccgagctgccgagagcaactctcctgttgctcgttctctcccccgctcgcaacgggcg
agaaggaccgcaatccgtcaacaccaacaccaccaccaccgtcaccaccacgcccatcac
cacaacctccatcaacaaccatccggtgactacccagttccggccagtggcagcaaccgg
acccagcccgtcccgtctgtggcgtcgtcgtcctcgccggcgtcgtcgcccattaaaaag
tcggcctcggccgtcgagtccgcggtcacgagtgcggcctccaaactcaacagcaaactg
cgacgcatgtcgaccaacgcgatctttagctttagtacgcataacagcaaccacactact
agtaacactaactgtaagtctaacaataaacctagtactagtgacggcgttagcgttagc
gttagcaataaatgtgatattttcaaccgcgggtccgccgcgagccgctcctcaaacccg
gccagtccggccaaacaggtcgtgcggagcgtgagcaacgacccgcagatcctcgccggg
gcgtcccacgtggcggcaccaccctcggagggtgccccggccaccgtgtcgccaagacgc
gactcgctgcccatcatcggcagtctgctgtcgtccttttcgtcctcgtcggtgtcctcc
tcgaactcgtcctcgctgtcgtcgtccacgttcggcacgggcagctgcagcaacagccac
gtggccaccactggcgccgcccacgtgggcccgccaaaaaccgcaagccgcaagctgcag
tctttgttttccgttagctcctgctacaacggaggtgcgtcgttgtccgctagggacgac
gacgacgatgacggtgacggtgacacgccgattgtctcgatccggaacgtggccgttgct
gctgccgctgccaagaaggccgcggggaacgcggttggtgttggtgatgacggcgtcggt
tatttggtcctcaactcgcccgagagtctcgtccgctaccggttgctgtcggagccggaa
atcgtgaatctgctcgtgaccaacggcaccacggcctcggcaccgtcctcaccacctggc
caccgccacgaagccgacgccgacgaagacgaggaggacgatgacggtggctcgtccagc
tgtcaatcgccgccatcttcgtccgctggcgtcgccggtcagactaacgcctctactaac
gcttccactaacacttctgccaacagtagcctggtgcaggcgtaa

DBGET integrated database retrieval system