KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009107Help
Entry
CpipJ_CPIJ009107  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CpipJ_CPIJ009107
Peptidases [BR:cqu01002]
 Metallo Peptidases
  Family M2
   CpipJ_CPIJ009107
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ009107
CD molecules [BR:cqu04090]
 Proteins
  CpipJ_CPIJ009107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6042070
NCBI-ProteinID: XP_001851224
VectorBase: CPIJ009107
UniProt: B0WR90
LinkDB All DBs
AA seq 621 aa AA seqDB search
MVTKVLVLALLASVALAVNPDLEDQELAGQKYVSDLEADILARNNEATEASWAYESDISE
AHLKARDEIQVRNANYFKEVARELRKYDWQNFKNGDLKRMFKKMTDLGYAALPEAKFTEL
LDAISSMSENYATAKVCDYKNREKCDLALEPELTEIFATSRDPEELKYYWTQWYDKAGTP
TREAFDKYIKLSNEAAKLNNLSSGAEAWLDAYEDETFEQQADAAIEQIRPLYEQIHAYVR
HKLRERYGEDVVSEKGPIPMHLLGNMWAQSWDNVADFTTPYPNSQLMDVTEEMVKQGYSA
KQMFEMGDDFFVSLNMTRLPQSFWEKSILEKPTDGRELVCHASAWDFYKTDDVRIKQCTR
INMEDFFTAHHELGHIQYFLQYQHQPSTYREGANPGFHEAVGDVISLSVSTPKHLEKIGL
LKDFVMDEEAKMNQFYRQGLSKLVFLPFAYTLDKYRYGMFRGEIKPDQANCKFWEMRTKF
SGIEPPVVRSEKDFDGPAKYHMSADVEYLRYLVSFIIQFQFHRSACELAGEYVKGDPVKT
LNNCDIYQNANAGNAIKEMLALGSSKPWPDAMEVLTGQRTMSADALLEYFQPLQDWLVVE
NKRLGAYVGWEKSDKTLLLDR
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaaaagtgctcgtgttggccctgctggccagcgtagccctcgcggtgaatccc
gacctcgaggaccaggagctggcgggtcaaaagtacgtcagcgatctggaggcggacatc
ctggcccggaacaacgaagccacggaagcgtcctgggcgtacgagtcggacatcagcgag
gctcacctgaaggcccgggacgagatccaagttcgcaacgcaaactacttcaaggaggtt
gcccgcgagctgcgcaagtacgactggcagaacttcaagaatggcgacctgaagcggatg
ttcaagaagatgaccgacctcggctacgctgctctgccggaggccaagttcaccgagcta
ctggacgccatctccagcatgtcggagaactatgccacggccaaggtgtgcgactacaag
aaccgcgagaagtgcgacctggcgctcgaaccggaactgacggagatcttcgcgacaagc
cgtgacccggaagagctcaagtactactggacgcagtggtacgacaaggctggaacccca
acccgggaagcgttcgacaagtacatcaagctgagcaacgaagcggccaagttgaacaat
ctctcatccggtgcggaagcctggctggacgcgtacgaggacgaaaccttcgagcagcaa
gcggacgccgccattgagcagatccgtcccctgtacgagcagatccacgcgtacgtccgg
cacaagttgcgcgagcgttacggtgaggatgtcgtttcggaaaagggacccattccgatg
cacctgctgggaaatatgtgggcccagtcgtgggataacgtggcggactttacgacgccg
taccccaacagtcagctgatggatgttacggaggagatggtaaaacagggttattccgca
aagcagatgttcgagatgggggatgacttcttcgtgtcgctgaatatgactcggctgccg
cagtccttctgggagaagagcatcctggagaagcccaccgacggtcgcgagctggtgtgc
cacgccagcgcctgggacttttacaagaccgatgacgtacgcatcaagcagtgcacgcgc
atcaacatggaggatttcttcacggcgcaccatgagctgggccacatccagtacttcctg
cagtaccagcaccagccgtcgacctaccgcgagggtgcgaaccccggtttccacgaggcc
gtcggagacgtcatttcgctgtccgtttccacgccgaagcacttggagaagatcggactc
ctcaaggatttcgtcatggacgaggaagccaagatgaaccagttctaccgccagggtctg
tccaagttggtgttcctgccgttcgcctacacgcttgacaagtaccgttacggtatgttc
cgaggggaaatcaagcccgaccaggccaactgcaagttctgggagatgcgcaccaagttc
tccggcattgaaccgccggttgtccgcagcgagaaggactttgacgggcccgccaagtac
cacatgtccgcggacgtggaatatctgcgctacctggtgtccttcatcatccagttccag
ttccaccggtcggcgtgcgaactggccggcgagtacgtcaagggggatcctgtgaagacg
ctgaacaactgtgacatctaccagaacgcgaacgctggcaatgccatcaaggagatgctc
gcgttgggatcttcgaagccgtggccggacgcgatggaggtgctgaccgggcagcgcacg
atgagtgccgacgcgttgctcgagtacttccagccgctgcaggattggctggtggtggaa
aacaagcggctgggtgcttacgtcggatgggagaagtcggacaaaacattgttattagac
agatag

DBGET integrated database retrieval system