KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010355Help
Entry
CpipJ_CPIJ010355  CDS       T01079                                 

Definition
(RefSeq) histone H3.2
  KO
K11253  histone H3
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CpipJ_CPIJ010355
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpipJ_CPIJ010355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF DUF2521 PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 6042910
NCBI-ProteinID: XP_001853968
VectorBase: CPIJ010355
UniProt: B0WTD1
LinkDB All DBs
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTE
LLLRKLPFQRLVREVAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERF
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcacgaagcaaaccgctcgcaagtccaccgggggaaaagcaccgcggaagcag
ttggccacgaaggcagctcgcaagagtgcgccggccaccggaggagtgaagaagccgcac
cgattccggccggggaccgtggcgctgcgcgagattcgccgctaccagaagtcgacggag
ttgttgctgcggaagctgcccttccagcggttggtgcgcgaggtcgcccaggatttcaag
acggatttgcggttccagagttcggccgtgatggcgctgcaggaggcctgcgaggcgtat
ctggtggggctgttcgaggacacgaacctgtgcgcgatccacgccaaacgtgtcacgatc
atgcccaaggacatccaattagctcgtcgcattcgcggcgagcgcttctga

DBGET integrated database retrieval system