KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010388
Entry
CpipJ_CPIJ010388  CDS       T01079                                 

Definition
(GenBank) cytochrome c-2
  KO
K08738  cytochrome c
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ010388
   04215 Apoptosis - multiple species
    CpipJ_CPIJ010388
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-ProteinID: EDS34402
VectorBase: CPIJ010388
UniProt: B0WTG4
LinkDB
AA seq 108 aa
MGVPAGDVEKGKKLFVQRCAQCHTVSAGGKHQVGPNLHGLMGRKTGQAAGYKYTDANKNK
GIVWTEDTLFEYLENPKKYIPGTKMVFPGMKKPAERADLIAYLKSATS
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggagttccggccggagacgtcgagaagggcaagaagctgttcgtgcagcggtgcgcc
cagtgccacacggtgtcggccggcggcaagcaccaggtcggtcccaacctgcacgggctg
atgggccggaagacgggccaggccgccgggtacaagtacacggacgcgaacaagaacaag
ggcatcgtctggaccgaggacacgctgttcgagtacctggagaacccgaaaaagtacatc
ccgggcacgaagatggtcttcccggggatgaagaaaccggccgagagggccgacctgatt
gcgtacctcaagtcggctacgtcttag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019024
Entry
CpipJ_CPIJ019024  CDS       T01079                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ019024
   04215 Apoptosis - multiple species
    CpipJ_CPIJ019024
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-ProteinID: EDS28661
VectorBase: CPIJ019024
UniProt: B0XHT8
LinkDB
AA seq 108 aa
MGVPAGDVEKGKKLFVQRCSQCHTVEAGGKHKVGPNLHGLMGRKTGQAAGFSYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPGERADLIAYLKSATA
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggtgttcctgccggagatgttgagaagggcaagaagctgtttgtccagcgttgctcg
cagtgccacaccgtcgaggccggtggcaagcacaaggtcggcccgaacctgcacggtctg
atgggccgcaagactggccaggctgccggattctcctacaccgacgccaacaaggccaag
ggtatcacgtggaacgaggacaccctgttcgagtacctggaaaaccccaagaagtacatc
cccggaaccaagatgatcttcgccggtctgaagaagcccggagagcgcgccgatctgatc
gcgtacctcaagtcggccaccgcctaa

DBGET integrated database retrieval system