KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011087
Entry
CpipJ_CPIJ011087  CDS       T01079                                 

Definition
(GenBank) beclin-1
  KO
K08334  beclin
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04136  Autophagy - other
cqu04137  Mitophagy - animal
cqu04140  Autophagy - animal
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ011087
   04136 Autophagy - other
    CpipJ_CPIJ011087
   04137 Mitophagy - animal
    CpipJ_CPIJ011087
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ011087
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ011087
   03029 Mitochondrial biogenesis [BR:cqu03029]
    CpipJ_CPIJ011087
Membrane trafficking [BR:cqu04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    CpipJ_CPIJ011087
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CpipJ_CPIJ011087
SSDB
Motif
Pfam: APG6 APG6_N FapA BRE1
Other DBs
NCBI-ProteinID: EDS35627
VectorBase: CPIJ011087
UniProt: B0WVM0
LinkDB
AA seq 424 aa
MNDAKVSVSFSCQRCLQPINIDDSFAALGEHTLAELALPINSHIEVDIESQLASLDHFVP
PFRFAESSGNDTNGFMLLSDGPDRESLSQNLRVKAELFDTLSNNSEIDHPLCDECTDTLL
ELMDKQLKMAEDEWNDYNNYLKKLEMTDDVPNIDQLEKELVDLKGEEERLLQELGELSRE
EDAIRSAVKEQETEKQRLSNEEEKYWREYTKHRRDVITTEDEFRSLECQMSYSQVQLDKL
KKTNVFNVTFHIWHSGHFGTINNFRLGRLPSAPVDWTEINAAWGQTCLLLSALARKMNLT
FKTYRLVPYGNHSHIEVLADGKELPLYGSGGFRFFWDTKFDAAMVAFLDCLQQFKEEVVK
KDPDFCLPYRMEKGKIEDSATGNSYSIKIQFNSEEQWTKALKFLLTNLKWGLTWVSSQFT
DEKH
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgaacgacgccaaggtcagcgtcagcttctcctgccagcgctgcctccagcccatcaac
atcgatgactcgttcgcggccctcggggagcatacgctggccgagctggcacttcccatc
aactcccacatcgaggtggacatcgagtcccagctggccagtttagaccactttgtgccg
ccgttccggtttgcggaatccagcgggaatgacaccaacgggtttatgctgctgtctgac
ggtccggatcgggaatcactcagccagaatttgcgcgtcaaagcggagctgtttgacacg
ctgtcgaacaactctgagattgaccacccgctgtgtgacgagtgcacggacacgctgctg
gagctgatggacaagcagctaaaaatggccgaggacgagtggaacgattacaacaactac
ctgaagaagctggagatgacggacgacgtgcccaacattgaccagctagaaaaggagctc
gtagatttaaagggcgaggaggaacgcctcctgcaggaactgggcgaactatcccgcgag
gaggacgccatccggtcggccgtcaaggagcaggaaacggaaaagcagcgactcagcaac
gaggaggaaaaatactggcgcgagtacaccaaacaccgccgagacgtcatcacgaccgag
gacgagttccggtcgctcgagtgccaaatgtcttactctcaggtccagctggataagctg
aaaaagaccaacgtgttcaacgtcaccttccacatctggcactcgggacactttggcacg
atcaacaacttccggctcggtcggctcccatccgctcccgttgactggaccgaaatcaac
gcggcctggggccaaacgtgtctcctgctgtccgcgctcgcccgcaagatgaacctcacc
ttcaagacgtaccgtctcgtcccgtacggcaaccactcccacatcgaagtcctggccgac
ggtaaggaacttccactatacggcagcggtgggttccgcttcttctgggacaccaagttt
gacgccgcgatggtcgccttcctcgactgtctgcagcagttcaaggaggaggtcgtcaag
aaggatccggacttttgcttaccctaccgcatggagaagggcaaaatcgaagactcggcc
accggaaacagctactcgatcaaaattcaattcaactcggaggagcagtggaccaaggcg
ctcaagtttctgctgaccaaccttaagtggggactgacctgggtgtcgtcgcagtttacc
gacgagaagcattag

DBGET integrated database retrieval system