KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011103Help
Entry
CpipJ_CPIJ011103  CDS       T01079                                 

Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ011103
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ011103
   04090 CD molecules [BR:cqu04090]
    CpipJ_CPIJ011103
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     CpipJ_CPIJ011103
Peptidases and inhibitors [BR:cqu01002]
 Metallo peptidases
  Family M1
   CpipJ_CPIJ011103
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ011103
CD molecules [BR:cqu04090]
 Proteins
  CpipJ_CPIJ011103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 6043869
NCBI-ProteinID: XP_001861458
VectorBase: CPIJ011103
UniProt: B0WVN6
LinkDB All DBs
AA seq 1030 aa AA seqDB search
MSSSAASLEAASESKRRSIVILSLIATCTFLFVLCLCLLSALVLVGKNLSAQTSPLLLSS
YFSSQQTSAGEVGGAKQKTPKSIDHFNRPALFDEDSQLSPDRAPEDNRTALTLPNSVYSG
SSPPGMNVLKMGSKVIEKLTFRLPRHIKPRHYDLLMRPDLDQQTFSGAVGIDVTVSEPTD
YFVVHSNLLTIGDTVLKRTLPDRSEQAVQIRRAYPYEPHQYWVIETESVEAGEYRISMNF
SGSLANRIVGFYSSSYRDKGSNTSRKIATSKFEPTFARQAFPCFDEPQLKATYTISLVHP
SSNGYEALSNMDIETIKPNTPSTGLSTTVFNPSVPMSTYLVVFIVSDFQHQATRIIPKIG
NQFDLRVYATPFQLENVRFARDTAKGVIEHYIDYFQIAYPLPKLDMAAIPDFVSGAMETW
GLVTYRETSLLYDAATSSTANKQRVAEVIAHELAHMWFGNLVTMKWWNELWLNEGFASYI
EYKGVDSVYPQWGIMEQFALDNLHGVLSLDATIGSHPIVVKVESPNQITEIFDTITYSKG
ASVIRMLEDFVSEPIFKQGVTAYLDKLKYSNGVSDDLMVELDKLFADATGATVAQVMDTF
TKQKGFPVINVVRSGSQFHLRQSRFLADPEAKETEPSQFDYKWYVPLTYITSDSPDTVKR
DWFPHTSSVVYVDLPTGTNPWIKFNHKQVGYYRVNYPADVWVQFGDALVADVNTFSTGDR
TGLLNDVFALADASMLKYDLALEMTRYLAREQEYVPWATVASKMKNIRNLIYDYESYDDI
TTYVRKLVQEAYNVVGWEVPQDSTEENHMRNRLRTTILDLACSFGHEDCLAQAKTRFEGW
LNSGAYIHPDLRTVVYYYGVQRSGSVSDWEKVKERFRAENDANEKAKLMSALAAFPDAKV
LRRFLEEAWDPTLVREQDHLSCIQNVAANKHGEQVAWDHVRENWNRLVERYTLGERNLGR
MIPSITGRFSTRVRLMELEDFFARNPESGAGATARVQALENISNNMKWLERNQKSVADWL
KTAVQPSVRR
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgagtgcggcttctctcgaagcggcaagcgagagcaaacggcgctcaatcgtg
atactctcactgattgcgacttgtacgttcctgtttgtgctgtgtctgtgtctgctgagt
gccctcgtgttggtcggcaaaaacttgtcggcacaaacgtctccactgctgctgtcttcg
tactttagcagtcagcaaacgtcagccggcgaagttggcggtgccaaacagaagacgccc
aagagcatcgatcattttaatcggcctgctttgtttgacgaagatagccagctatcgccg
gaccgtgcccccgaggacaaccgcactgcgctcacactgccaaactcggtgtattctgga
tcgtcgccgccgggaatgaacgtactcaagatgggctccaaggtgattgagaagctgacg
ttccggctgccgcggcacatcaaaccgcgtcactatgatttgctgatgcgaccggatctg
gaccagcagacgttcagcggagcggtcggcatcgacgtgaccgtgagcgagccgacggat
tacttcgtggtgcacagcaacctgctgaccatcggcgacacggtgctgaagcggacgctg
ccggaccggtccgagcaggccgtgcagattcggcgtgcgtacccgtacgaaccgcaccag
tactgggtcatcgagacggaaagtgtcgaggcgggcgagtaccggatcagtatgaatttt
agcggaagcctggccaaccggattgtgggcttctacagcagttcgtaccgggacaagggc
agcaatacttccagaaaaatcgccacatccaagttcgagccaacgttcgcgcgtcaggcc
ttcccgtgcttcgacgaaccccagctgaaggcaacgtacaccattagcttggtccatccg
tccagcaatgggtacgaagcgctgtccaacatggacattgagaccattaaaccaaacact
ccgtcaactgggctcagcactaccgtgttcaatccgagcgttccgatgagcacctatctg
gtggtgtttatcgtcagcgacttccagcatcaggcaactcgtatcattcccaagattggt
aatcagtttgacctgcgggtgtacgccacccctttccagcttgagaatgttagatttgcc
cgggatactgccaagggagttattgagcactacatcgattacttccaaatcgcgtatccg
ttgccgaagctggatatggccgccattccggactttgtgtcgggagctatggagacgtgg
ggcttggtaacgtatcgggagaccagcttgctgtacgacgcagcaacgagctcgacggcc
aacaagcagcgcgtagcggaagttatagcccacgagttggcccacatgtggtttggaaat
ctggtcacgatgaagtggtggaacgaactgtggttgaacgagggatttgccagctacatc
gagtacaagggagtggacagtgtatatccgcagtggggcattatggagcagtttgcgctg
gataatctgcacggagtgctcagtttggatgccaccattggatcgcacccgatcgttgtc
aaggttgagagtccgaatcaaattacggagatctttgacaccatcacgtactctaagggc
gcgtcggtgatccgcatgttggaggactttgtgtcggaaccgatcttcaagcagggcgtt
acggcctacttggacaagctcaagtatagcaacggagtctcggatgatctcatggtggag
ctggataagctgttcgcggacgcaacgggagcgactgttgcgcaagttatggacactttt
accaagcaaaagggtttccccgttatcaacgttgtcagaagcggcagtcaattccatttg
aggcaatcgcgtttcctagctgacccggaggcgaaggaaactgaaccgtcgcagtttgac
tataaatggtacgtcccgctgacttacattacctccgacagtccggacacggtcaaacgc
gactggttcccgcacacctcttcagttgtgtacgtcgatctgccaactggaactaatccg
tggatcaagttcaatcacaagcaagttggttactatcgcgtgaactatccggcagacgtt
tgggtccagttcggggacgctctggtggccgatgtgaacactttctccactggagatcgt
accggactgttgaacgatgtttttgcactggccgatgcttcgatgttaaagtatgatttg
gctcttgagatgacgcggtacttggcccgggagcaggagtacgtcccgtgggcaacggtt
gcgagcaaaatgaagaacattcgaaacctgatctacgattacgaatcttacgatgatatc
acgacctacgttcgcaagctggtccaagaggcgtacaatgtcgttggttgggaagtgcca
caagattccactgaagaaaaccacatgagaaaccgtctccgtaccaccatcctggatttg
gcctgctccttcggtcacgaagactgtctcgcccaagctaaaactcgcttcgaaggatgg
ctcaactccggcgcgtacatccaccctgatctgcgcaccgtagtgtactactacggcgtt
cagcgatcgggctcggtctcggactgggaaaaggtcaaggaacggttccgcgcggagaac
gatgccaacgagaaggccaagctgatgagtgcgcttgccgccttcccggacgccaaggtg
cttcgtcggttcctggaagaggcgtgggatccgacgctggttcgcgagcaggatcatctg
agctgcatccagaacgtggccgcgaacaagcacggcgaacaggtcgcgtgggaccacgtg
cgcgagaactggaaccggctggtggaacggtacacgcttggtgagcggaaccttggccgc
atgattccgtccatcacgggccgtttctcgacccgggttcggctgatggagctggaagat
ttcttcgcgcggaatccggaatcgggcgcgggagcaactgcccgggtgcaggcgctggag
aacatctccaacaacatgaagtggctggagcgcaatcagaagagcgttgccgattggctc
aagactgccgttcagccgtcggtgagacgataa

DBGET integrated database retrieval system