KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012311Help
Entry
CpipJ_CPIJ012311  CDS       T01079                                 

Definition
(RefSeq) histone deacetylase
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cqu01009]
    CpipJ_CPIJ012311
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cqu03019]
    CpipJ_CPIJ012311
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ012311
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ012311
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CpipJ_CPIJ012311
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpipJ_CPIJ012311
Messenger RNA biogenesis [BR:cqu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CpipJ_CPIJ012311
Membrane trafficking [BR:cqu04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    CpipJ_CPIJ012311
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     CpipJ_CPIJ012311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 6044974
NCBI-ProteinID: XP_001862395
VectorBase: CPIJ012311
UniProt: B0WYC3
LinkDB All DBs
AA seq 1108 aa AA seqDB search
MYKFKKIYAVSSTVVTRQGAQKTKITTRAQRASVEAAETERKAKFYGTRKPNPALAEAKK
RGKLKMSTEPKEGAANPDQNGGVVQLKDIYGSAIAATELVRGPTGLVYDEKFAEHRCLWD
DGYPECPERFTRVLERCRELKLVERCAVIEPRMASEEEVLTKHTPEQLEILKSTRGSQDV
AALEELSSHYDAVFIHPSSYDCSLLSAGSTIELVDAILEGRVQNGMAIIRPPGHHAMKAE
YNGYCFFNNVAIAAQHALDKRGLKRILVVDWDIHHGQGTQRMFYDDPRVLYFSIHRYECG
TFWPNLRESDFDCIGEGAGLGYNFNVPLNRIGMTNGDYLAIWQQLLLPVALEGQMEITPA
FYPHLLSPLMSLAQGKVAVVLEGGYCLTSLAEGGALTLRALLGDPCPLLVEKLQPPCESM
QQTILNCVHSHRPYWKNLQLNATYGLEELNNVNPQPNFHQVIQYYVQQEPKPEPVRYETR
NCYPVQASEEKNRIEERLAMLQIATRLTFPATRVCYVYDDLLLEHRNLHEDLHPEQPQRI
ARIFSRHEEYKLLPRMKRLKPRHATTDELCLVHSRQHVNVIRRTVEREEMKQVADKFNSV
YFHPKTFECATLATGSVLQVVDEVLNGQSRSGVCIVRPPGHHAESDMPHGFCIFNNVAIA
AQYAIRDHGLKRVLIVDWDVHHGNGTQHIFESNPKVLYMSVHRYDNATFFPKSKDANYDS
VGNGTGEGFNVNIPWNKKGMGDQEYAAAFQQVILPIAYEFDPELVLVSAGFDAAIGDPLG
GCKVTPEAYGHFTHWLSSLANGRVIVCLEGGYNVNSISYAMTLCTKSLLGDPLPMLHVSQ
RYNGPNAACVESIRNVLSVQEKFWKSLKFNKKLPDFRSATGEADLNSAFGKLQLSAGTSG
SSTDSSPAKNSSDDSGVPFDGDDQPGPSRRRNKQTTDGQQSASGSSGAGEGSSNSGTKQE
TLQDFLAANLEALQNEEMFAVIPLRDCPHLKELNPDNIPDKISTNAPCTGCESSVENWVC
LLCFNVCCGRYINEHAIEHATVTEHPLALSFSDLSVWCYKCESYVDNPVLYPYKNLVHQD
KFGGEQLVWSYGSDLVLDVKPPTTKTKE
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattcaagaagatttatgctgtgagttccaccgtcgtgactcgacagggcgcc
caaaagaccaaaatcacaacccgagcccagcgtgcgtcggtcgaagcggcggaaaccgaa
cgaaaggccaaattctacggaaccagaaagcccaacccagcgctcgcggaagcgaaaaag
cgaggcaagctgaaaatgtccacggaaccgaaggaaggggcggccaatccggaccagaac
ggtggcgttgtccagctgaaggacatttacggcagcgcgatcgccgcgacggaactggtc
cgcgggccgaccgggctggtctacgacgagaagtttgccgagcatcggtgcctgtgggac
gacggatatccggagtgtccggagcggttcacccgggtgctggaacggtgccgggaactc
aagctggtcgagcgatgtgccgtgattgaacctcggatggccagcgaggaggaggtgttg
acgaagcatacgcccgagcagttggagattctcaagagtacacggggctcgcaggatgtg
gccgcactggaggaactaagttcgcattacgacgcggtctttatccatccgtcatcctac
gattgttcgctactatcagcgggtagtacgatcgagctggtcgatgcaattttggagggg
cgtgtgcagaacggaatggccatcatccggccgccgggtcaccacgccatgaaggccgag
tacaatgggtactgcttcttcaacaacgtggcaattgcggcgcagcatgcgctcgataag
cgtggactgaagcggatcctggttgtcgactgggacatccaccacggacagggaacgcag
cggatgttttacgatgatccgagagtcctgtatttttcgatccatcgctacgagtgcgga
acgttctggccaaacctgcgcgagtccgactttgactgcatcggcgaaggcgctggactg
ggctacaactttaacgtcccgctcaaccgaatcggaatgaccaacggagactatctggcc
atttggcagcaactattgctaccggtggcactggagggccaaatggagattacgccggcg
ttttaccctcacctcctttcaccactgatgtccctagcgcaaggcaaggtcgccgtagtc
ctggaaggtggctattgcttgacgtctctcgccgaaggaggcgcgttaacgttgcgtgcc
ctgctgggagatccgtgtccgctgctggtcgagaagcttcagccgccgtgcgaaagcatg
cagcagactattctgaactgcgtccattcgcatcgaccgtactggaagaatttgcagctg
aacgcgacgtacggattggaagagttgaacaacgttaatccgcagccaaactttcaccaa
gttattcagtattacgtccagcaggagccaaagccggaaccggttcgatatgaaacgaga
aattgttatcccgtccaggctagtgaagagaagaatcggatcgaggagaggctagctatg
ctgcagattgcaaccaggttgaccttcccggcgacccgggtttgctacgtgtacgacgat
ctgctgctcgagcatcgcaatctgcacgaggatcttcatccggagcaaccgcaacgaata
gccagaatcttttcgcgccacgaagagtacaaactgttaccacgaatgaagcgacttaag
ccacgtcacgcgaccactgacgaactgtgtctggtgcactcgcgccagcacgtgaacgtg
attcggaggacggtcgagcgggaagagatgaagcaagtggcggacaagttcaactccgtg
tacttccatccgaagacgttcgagtgcgccacgctggcgaccggatcggtgctacaggtc
gttgacgaagtgctgaacgggcagtcccgtagcggtgtgtgcattgtacgaccgccgggg
caccacgccgagtcggatatgccgcacggattttgcatctttaacaacgtggccattgcg
gcgcagtacgcaatccgcgatcacgggctgaagcgagtgttgatcgttgattgggacgtg
caccacggtaacggaacgcaacacatctttgagagcaacccgaaggtcctttacatgtca
gtccatcggtacgacaacgcgaccttcttcccaaagagcaaggatgcgaattacgactcc
gtgggaaatggcaccggtgaaggcttcaacgttaacattccatggaacaagaagggcatg
ggagatcaagaatatgccgcagccttccaacaagtcatcctaccgatcgcgtacgagttc
gatccggaactggtcctagtttcagctggttttgatgccgccattggtgatccactcggc
ggttgcaaggtcacgccggaagcatacggacacttcacccactggctttcctcgctggcc
aacggtcgtgtgatcgtgtgcctcgagggaggttacaacgtaaactcaatctcctacgcg
atgaccctctgtacaaagtccctcctgggtgatccactcccgatgctacacgtcagtcaa
cgctacaatggaccaaacgctgcctgcgtcgaatcgatccgaaatgtgctgtcggtgcag
gaaaaattctggaagtcgctcaaattcaacaaaaaactacccgactttcgcagtgccaca
ggcgaagccgacctgaacagcgccttcggtaagctgcaactttctgcgggaacctctgga
tcttcgacggactcgtccccagcgaagaactcgagcgacgattcgggcgttccgttcgat
ggtgacgatcaacccggaccaagccgaagacggaacaagcaaaccactgacggtcaacag
agcgcatccggtagcagtggagccggtgaaggatcttccaactcgggaacgaagcaagaa
acgttgcaggatttcctagctgcaaacttagaggccttacaaaacgaggaaatgtttgcc
gtcatcccgttacgagactgcccccaccttaaggaactcaaccccgacaacatccccgat
aaaattagtacaaacgctccgtgcaccggctgcgagtcctccgtggaaaactgggtctgc
ctgctgtgcttcaacgtgtgctgcggtcgctacatcaacgaacacgcaatcgaacatgcc
acggtcacggaacatccgctcgcgctaagcttcagcgatctgtccgtgtggtgttacaag
tgcgagtcctacgtcgacaacccggtcctgtacccgtacaagaatctcgtgcaccaggac
aagtttggcggcgaacagctagtttggtcgtacgggagtgatctcgtcctcgatgtgaaa
ccgccaacgaccaaaacgaaagaatga

DBGET integrated database retrieval system