KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012653
Entry
CpipJ_CPIJ012653  CDS       T01079                                 

Definition
(GenBank) septin
  KO
K16943  septin 4
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ012653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ012653
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cqu04812]
    CpipJ_CPIJ012653
Membrane trafficking [BR:cqu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    CpipJ_CPIJ012653
Cytoskeleton proteins [BR:cqu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     CpipJ_CPIJ012653
SSDB
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 Ras Dynamin_N AAA_22 GTP_EFTU AAA_16 TarH AIG1 Roc AAA_29 ABC_tran AAA_23 POR
Other DBs
NCBI-ProteinID: EDS37805
VectorBase: CPIJ012653
UniProt: B0WZY0
LinkDB
AA seq 381 aa
MSERSRKACSLQLEPERDYIGFATLAEQVHRKSVKRGFEFTLMVCGESGLGKSTLVNSLF
LTDLYGARSVPYAEERIEKTTKIDKKTLDIEEKGVKLRLTIVDTPGFGDSINCEDSWRVC
TQYIDEQFRQYFTDESGLNRRNIQDNRVHCLLYFIPPWGHGLRQLDMDLMRRMHKKVNIV
LVIGKADTLTTTEVQKLKTRVLEDIEANGIQIYQFPDCDSDEDEEFKQQDRELKASIPFA
VVGSNIILEVAGKKIRGRQYPWGVVDAENPQHSDLIKLRNMLISTHMQDLKDTTRDVHYE
NFRAQCISQISQHALRERNKLKRESIASSHDPQTQTPNNSINETDRLLQQKEEEIRRMQD
MLTQMQEKLKSTQLNDAVIDV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagcgagcgctcacggaaagcttgctcgctccagctggagcccgaacgcgactacatc
ggcttcgccaccctggccgaacaggtgcaccgaaagtcggtgaagcgcggcttcgagttc
acgctgatggtgtgcggcgagagtgggctcggcaagtccacgctggtcaacagcctgttc
ctgacggatctgtacggggcgcggtcggtgccgtacgccgaggagcgcatcgaaaagacg
accaagatcgacaaaaagacgttggacatcgaggagaagggggtcaagctgagactgacg
atcgtggacacgcccggctttggggactcgatcaactgcgaggacagttggcgggtgtgt
acgcagtacattgacgagcagttccggcagtactttaccgacgagagcgggctgaaccgg
cggaacattcaggacaatcgggtgcactgtttgctgtactttataccaccgtggggacat
ggactccgtcagctggacatggacctgatgcggcggatgcacaaaaaagttaacatcgtg
ctggtgatcggcaaggcggacacactgaccacgaccgaagtgcaaaagctgaagacgcgc
gtcctcgaggacatcgaagcgaacgggatccagatctaccagtttccggactgcgactcc
gacgaggacgaggagttcaagcagcaggaccgcgagctgaaagcgagcattccgttcgcg
gtggtcggcagcaacatcatcctggaggtcgccggcaagaagatccggggccgtcagtac
ccgtggggagtggtggacgccgaaaacccgcagcactcggatctgatcaagctgcgcaac
atgctcatctcaacccacatgcaggacctcaaggatacgacgcgggacgtgcactacgag
aacttccgggcgcagtgcatttcgcagatctcgcagcacgcgctgagggagcgcaacaag
ctgaaacgggaatcgatcgcttccagccatgacccgcagacgcaaacgcccaacaacagc
atcaacgagacggatcggctactgcagcagaaggaggaggagatccgtcgaatgcaggac
atgctgacgcagatgcaggaaaaactgaaatcgacccagctgaacgatgccgtcatcgac
gtctag

DBGET integrated database retrieval system