KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012779Help
Entry
CpipJ_CPIJ012779  CDS       T01079                                 

Definition
(RefSeq) potassium/chloride symporter
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cqu02000]
    CpipJ_CPIJ012779
Transporters [BR:cqu02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   CpipJ_CPIJ012779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12 zf-C4H2 Paf1 Band_3_cyto YiaAB DUF4589 COX14
Motif
Other DBs
NCBI-GeneID: 6045684
NCBI-ProteinID: XP_001862998
VectorBase: CPIJ012779
UniProt: B0X026
LinkDB All DBs
AA seq 952 aa AA seqDB search
MLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIV
LTYMAPWLSIFGDFTKDQSAMYNNFRVYGTGLLCVMGLIVYLGVKFVNKFATVALACVIF
SIIAVYAGIFNNIDGNDKLFMCVLGKRLLKDIAVDNCTKEAGGPLYNIFCEDGGECDPYF
KEHNVSLIRGIKGLRSGVFFDNIFPSFLQEGQFISYGMDPDDIEPLDRPSYNQVFADCTT
AFTILIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTIGAILTTSTVYLSCVMLFAGTVD
NLLLRDKFGQSIGGKLVVANMAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKDGI
IPFLEPFAVSSKRGEPTRALLLTLLICQSGILLGNVDLLAPLLSMFFLMCYGFVNLACAV
QTLLRTPNWRPRFKYYHWSLSLIGLTLCMSIMFMTSWYFALIAMGLAVLVYKYIEYRGAE
KEWGDGIRGIALSAARYSLLRLEEGPPHTKNWRPQILMLAKLNDDLTPKYRKLFSFVSQL
KAGKGLVVVVALVKGDFTKLSSEALAAKQSVRKTMEDEKVKGFCDAMVASNIADGLSHVV
QTIGLGGMKPNTVILGWPYGWRKNEDDARTWQVFLQTVRNVSAAKMALLVPKGINFFPTS
SDKISGNIDIWWIVHDGGLLMLLPFLLKQHRSWKNCKMRIFTVAQMEDNSIQIKKDLKMF
LYHLRIEAEVEVVEMMDSDISAYTYERTLMMEQRNQMLRKLRLNKREKENVVQAIVDHHH
HIENNTKTASKVRFADPSENKDIFNDDDREEKNETESEKDKDTKESEQDKDGGAANNNEN
SEQLPPPPQPTANNVASPGKKGSSGGDETPKSPKKPDQANVRRMHTAVKLNEVIVNKSHD
AQLVILNLPGPPKETNVERESNYMEFLEVLTEGLERVLMVRGGGREVITIYS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgttaactgccatttcgatgtctgcgattgccacgaacggggtggtacctgcgggcggg
agctacttcatgatatcaagatctctcgggcccgagtttggtggcgctgtcgggatgttg
ttctacaccgggacaacgttagcagccgccatgtacatagtcggtgcggtcgaaatcgta
ctgacgtacatggcaccgtggctgtcaatattcggcgacttcaccaaggatcaatcggcg
atgtacaacaactttcgcgtgtacggcacgggtctgctttgtgtaatggggctgatcgtc
tatctgggtgtcaaattcgtcaacaagttcgcaaccgtggcgctggcctgtgtcatcttc
tccatcatcgcggtctacgccggtatcttcaacaacatcgatggcaacgataagctgttc
atgtgcgttctgggaaagcgtctgctgaaggacattgccgttgacaactgcaccaaggaa
gccggcggaccgctgtacaacatcttctgcgaagatggcggagaatgtgacccgtacttc
aaagaacacaacgtttcgctcatacgaggcatcaagggactccggagtggcgtctttttc
gacaacattttcccatcgtttttacaagaaggacaattcatctcgtacggaatggatccg
gatgatatcgaacccctggacaggccctcttacaaccaagtgtttgccgactgtaccacc
gcgtttacgatactgatcggtatcttcttcccttcggtgacaggtatcatggctggctcg
aaccgctccggagatttggcggacgcacaaaagagtatcccgatcggtacgatcggcgcc
atcctgacgacctcgaccgtgtacctgtcctgtgtgatgctcttcgccggtaccgtggac
aatttgctgctgcgtgacaaattcggacaatcgataggtggtaaactagtcgtggcgaac
atggcctggccgaaccagtgggtcatcctgattggttcgttcctgtcaaccctcggtgcc
ggactgcagagcttaaccggcgcgccccggctgctgcaggccatcgccaaggacggcatc
atcccgttcctggagccgttcgccgtgtcatcgaagcgtggcgaaccgacccgggccctg
ctcctgaccctgctaatctgccagagtggcatcctgctcggaaacgtcgacctgctcgcc
ccgctgctgtccatgttcttcctgatgtgctacggcttcgtgaatctggcctgcgccgtc
cagacgctgctgcggacccccaactggcggccacgcttcaagtactaccactggtctctg
tcgctcattgggctgacgctttgcatgtcgattatgttcatgacgtcgtggtactttgcg
ctgatcgcgatgggactggccgtgctcgtctacaagtacattgagtaccgaggcgccgaa
aaggaatggggtgacggaatccgcggtatcgccctgtccgccgcccgctactcgctgctc
cggctggaggaaggccccccgcacaccaagaactggcgcccccagatcctgatgctggcc
aagctgaacgacgacctgacgcccaagtaccgcaagctgttctcgttcgtgtcgcagctc
aaggccggcaagggtctggtcgtggtggtggcgctcgtcaagggtgactttacgaagctg
tcgagcgaagcgctggccgccaagcagagcgtccgcaaaacgatggaggacgagaaggtg
aagggcttctgcgacgcgatggtcgcgagcaacatcgccgacgggctgtcgcatgtcgtc
caaacgatcggtctgggaggtatgaagccgaacacggtgatcctgggctggccgtacgga
tggcgcaagaacgaggacgacgcccgaacctggcaggtgttcctgcagacggtgcgtaac
gtcagcgcggccaagatggcgctgctcgtgcccaagggcatcaacttcttccccacgtca
tcggataagatatccggcaacatcgacatctggtggatcgtgcacgacggtggcctgctg
atgctgttgccgttcctgctgaagcagcaccgctcctggaagaactgcaagatgcgcatc
ttcaccgtcgcccagatggaggacaactcgatccagatcaagaaggacctcaagatgttc
ctgtaccatctgcgtatcgaggccgaggtggaggtcgtggaaatgatggatagcgatatc
tcggcgtacacgtacgagcgcaccctgatgatggaacagcgcaaccagatgctccgaaag
ttgcggctcaacaagcgcgaaaaggagaatgtcgttcaagccatcgtggaccaccaccac
cacatcgagaacaacaccaagacggcatccaaggtacggttcgcggatccctcggagaac
aaggacatcttcaacgatgacgaccgcgaggaaaagaatgagactgaatccgaaaaggac
aaggacaccaaggaaagcgaacaggacaaggacggcggggcggcgaacaacaatgaaaat
tccgaacagcttccgccgccgccccagccgacggccaacaatgtggcctcgcccggcaag
aagggctcctccggcggggacgaaacgcccaaatcgcccaagaagcctgatcaagccaac
gtgagacgaatgcacacggccgtgaagctcaacgaggtcatagtcaacaagtcgcacgac
gcgcagctcgtcatcctgaacctgcccggcccaccgaaggagacgaacgtggagcgcgag
agcaactatatggaattcctggaggtcctaaccgagggtctggagcgagtactgatggtg
cggggcggcggccgagaagtcatcaccatctactcttaa

DBGET integrated database retrieval system