KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014995
Entry
CpipJ_CPIJ014995  CDS       T01079                                 

Definition
(GenBank) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
cqu04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ014995
   04215 Apoptosis - multiple species
    CpipJ_CPIJ014995
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    CpipJ_CPIJ014995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ014995
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     CpipJ_CPIJ014995
Peptidases and inhibitors [BR:cqu01002]
 Cysteine peptidases
  Family C14: caspase family
   CpipJ_CPIJ014995
SSDB
Other DBs
NCBI-ProteinID: EDS41270
VectorBase: CPIJ014995
UniProt: B0X6C0
LinkDB
AA seq 527 aa
MSTTLSVEDLDFIECELSFDDKVSLLFILYGQRNPRYLSQIITIACRSPEEETHYLFDWK
NHAAGPEWSSELLEALLIIQANLCLVKCGLDDDELRERFLPHVIELTSFVHPVLKGLYLL
CEKMDDGLAGKVIDYLKKTHSVGVLNSRFFELVLLELISEDFVKLGSKSAGEECDLLLLV
ACFKSLDLYDLAEFCKRISDSFNKELTNKQNQSDNVQGSSNFKQIPKIEDQQQLDPDRYY
ILKQHAGIILIINQFKFHRDQNPELQDLLPLRPLNDRRGTEVDKLAILNIFTAFGYQTAS
RSPPPSKRRKVNPLFPLVVCLLSPWSGRAKSTASLNSIPVNVKSIERAMAAEKPDPESPS
CYLCKLVKGRKFCPVGPGRDSAKAWNTTALSSEKTAFRCLWNLSGGPWSTRSQKVVARVG
FFRFSKENQEYWLKLCGYGREEELKSQRICSVKVTRSLLPVVANTEEVYLRETTGTHQEP
SFPSPLLSRSSGTQDPSANPFAARRFPPCRAGGCVRCLRGIISSGFN
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgagcaccacactatccgttgaggacctagacttcatcgaatgtgaattaagctttgac
gataaggtttccctactctttattctgtacggccaacgaaacccgcgatatctttcacaa
attatcacgatcgcttgtcgctcaccggaagaggaaactcactatctgtttgactggaag
aatcacgctgctggaccagaatggagttcagaactgttggaagcccttttgattattcag
gcgaatctatgtctggtcaaatgtggcctcgatgacgatgagctgcgggagcgtttcttg
cctcacgtgatcgagttgaccagctttgtccatccggtgttgaagggactgtatttgcta
tgtgaaaagatggacgatggcttagctggaaaggtgattgactatttgaagaaaactcat
tccgttggggtactgaactcgaggttttttgagctggtacttttagagttgatttctgaa
gatttcgtcaaacttggctcaaagtctgctggagaagagtgtgacctgctacttctagta
gcatgtttcaaatcgttggatctatacgacctggcagagttttgcaagcgaatttcagac
agtttcaacaaagaactgaccaacaaacagaaccagtccgacaatgtccagggctcgagc
aatttcaagcagataccaaagattgaggatcagcaacaactcgatcctgatcgatactat
atccttaaacagcacgctggcatcattctgatcatcaaccagttcaaattccaccgagac
caaaatccagaacttcaagacctgcttccccttcggccgctcaacgatcgtcgtggaacc
gaagtggacaagctggccatcctaaacatcttcacggcgttcggctaccaaaccgctagt
cgaagcccaccgccgtccaaacgccgtaaagtcaacccactgtttcccctggtggtctgt
ctgctctccccatggtcaggaagggcaaaatctacggccagtctaaacagcattccagtc
aacgtaaaatccatcgagcgggcaatggccgcggaaaaacctgacccggaaagcccaagc
tgctatttgtgcaagcttgtcaagggccggaaattctgcccagtcggcccgggtagagat
tccgcaaaagcttggaacacgacggccctttcatcggaaaagacggcgttccggtgtttg
tggaacctttctggtgggccttggtccacgagatcgcaaaaggttgttgcgagggtggga
ttctttcggttttcgaaggaaaatcaagaatactggttgaaactgtgcggctatggcaga
gaagaggagttaaaatctcagaggatttgtagcgtgaaagttacccgttcgctactacca
gttgttgccaataccgaggaggtttatctacgggagacaaccggaacacaccaggaaccg
tcttttccgtcacccctgttgtcgaggtcctccggcacccaagatccgtcagctaatcca
tttgccgcacgtcgttttcctccctgccgcgccgggggatgtgttcgatgtctccgcgga
ataatctcgtccggtttcaactga

DBGET integrated database retrieval system