KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016031Help
Entry
CpipJ_CPIJ016031  CDS       T01079                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04146  Peroxisome
cqu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CpipJ_CPIJ016031
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CpipJ_CPIJ016031
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CpipJ_CPIJ016031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 6049608
NCBI-ProteinID: XP_001866335
VectorBase: CPIJ016031
UniProt: B0X9L3
LinkDB All DBs
AA seq 153 aa AA seqDB search
MPVKAVCVLSGDVKGTIYFEQNADSDAVKVTGEVTGLKAGNHGFHIHEFGDNTNGCTSAG
PHFNPHGKEHGAPDASVRHAGDLGNVVADAGGVAKVDITDKQISLSGPLSILGRTVVVHA
DPDDLGVGGHELSKTTGNAGARLACGVIGICKA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcaaagccgtctgcgtgttgagtggagacgttaaggggacgatttactttgag
cagaatgccgattccgacgccgtgaaggtaacgggcgaggtcaccgggctgaaggccgga
aaccacggcttccacatccacgagtttggcgacaacaccaacgggtgcacctcggccggg
ccgcactttaacccgcacggcaaggaacacggcgccccggacgcgtccgtccgtcacgcc
ggagatttgggcaatgtggtggccgatgcggggggcgtggccaaggtcgacatcaccgac
aagcagatctcgctgagcggaccgctgagcatcctgggccgcaccgtggtcgtgcacgcc
gatccggacgatctgggcgtgggcggacacgagctgagcaagaccaccggaaatgcgggc
gcccggctggcctgcggcgtgattgggatttgcaaagcttaa

DBGET integrated database retrieval system