KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016658Help
Entry
CpipJ_CPIJ016658  CDS       T01079                                 

Definition
(RefSeq) angiotensin-converting enzyme
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6050056
NCBI-ProteinID: XP_001866723
VectorBase: CPIJ016658
UniProt: B0XAQ1
LinkDB All DBs
AA seq 588 aa AA seqDB search
MCNRVTNSEWKFAINSTEFNKRRMREQQNLASKFECLSWRRAASFDSSTIVDTGIRRQLG
RIVEPGRCGLGDDKYAEITHVISLMKENYNNAKVCPYHGPHATAIAAQSANYVTGYATYC
DLKLEPDLVQIMETSKVEPELKHYWTAWREKSGPPVKNTFMRYIDLANQAAERHGFNDAG
DQMRSVYDDSDFFFTVNDLWTKVQPLYKQLVTFARKGLVRQYGEHVVRRDGPIPAHLLGN
MWGQNWRNILDIIRTSPPEMPDITGEMVRQGYTPLKMFQTAEEFFTSIGLPPMAPEFWRN
SLLQKSNEVTGNCAASAWDFCNKVDFRIKQCTQVTLDDFINAHHEMTHVQYYMQYSSQPF
LYREGPNPAFHEALANAISLCVGGPAHLQKLGLLNTAVSVLNGNTMINIEYLLNLALDKL
PFMAFSLALEKWRWYVFEKGPVGMNARWWELRLRYQGIIPPLVRGYEHFDAGAKFHVISD
QDYIKYFVATVLQFQIYSELCLASHHVGPLHTCNFYRSREAGRIISDVMQQGASLTSSQL
IKLLTRGKTSRLSVEPLLDFFRPLEAWLELQNRDEPVICYFAFTRRFF
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaccgagtcaccaacagcgagtggaagttcgcgatcaactcgaccgagttcaac
aagcggcgcatgcgcgaacagcaaaatctggccagcaaatttgagtgtctgagctggcgc
cgggcagcttcgttcgattcctcgaccatcgtcgacaccggaatccgccgtcagctgggc
cgaatcgtggagccggggcggtgcgggctgggcgatgataagtacgcggagattacgcac
gtgatttcattgatgaaggagaactacaacaatgcgaaagtgtgtccatatcatggaccg
catgccacggcaatcgctgcccaaagcgccaactatgtgaccggatatgcaacgtactgc
gatctgaagctggaaccggatctagttcagatcatggaaacgagcaaggtggagcccgag
ttgaagcactactggacagcatggcgggaaaaatctggaccccctgtgaagaacaccttc
atgcggtacatcgatttggccaaccaagcggcggaacgtcacggttttaacgatgccgga
gaccagatgaggtccgtttacgacgacagtgacttcttctttacggttaacgatctctgg
acaaaagttcaacctctgtacaaacagttggttacgttcgcacggaagggtttggtacgg
cagtacggtgaacacgtggtccgaagggacggtccgattccagctcatcttttaggtaac
atgtggggtcaaaattggcgcaacatcctggacataatccgaacgagtcctcccgagatg
ccagacattacgggtgaaatggttcgccaaggttatacgcccctgaagatgtttcaaacg
gcggaagagtttttcacctcgattggtttgccaccgatggctccggagttttggcgcaat
tcgctgcttcaaaagtccaacgaagtcacgggcaattgtgctgcttcggcgtgggacttt
tgcaacaaggtagactttcgcatcaagcagtgcacccaggtaacgttggatgatttcatc
aacgctcaccatgaaatgacgcacgtccagtactacatgcaatactcgagccaaccgttt
ctgtatcgcgagggaccaaacccggcgttccacgaagcgttggccaacgcaatcagcctt
tgcgtaggaggaccagcacacttgcagaaattgggacttctaaacactgccgtttcggtg
ctcaacggaaataccatgatcaacatcgaatacttgctaaacctggccctggataaactc
ccatttatggctttcagtttggcactggaaaagtggcgctggtacgtctttgagaaagga
cccgtaggcatgaacgcccgctggtgggaactgcgactccgttatcaaggcattatccct
cccttagtcagaggatacgagcatttcgatgccggcgcaaaatttcacgttatttccgac
caagattacatcaaatacttcgttgcgaccgttctgcagtttcaaatttattctgaactt
tgtcttgcatcgcaccacgttggcccactgcacacgtgcaacttttatcgctcgcgtgaa
gcgggaagaatcatcagcgatgtaatgcagcaaggtgcctccctcacctcgtcgcaactg
attaagcttctgacgcgtgggaaaacgtcgcgactttcggtggagccgctgctggacttt
ttcagaccgctcgaagcatggttggagctgcagaacagagacgaacccgtaatttgttat
ttcgcgtttactagacgatttttctaa

DBGET integrated database retrieval system