KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ017286
Entry
CpipJ_CPIJ017286  CDS       T01079                                 

Name
(GenBank) conserved hypothetical protein
  KO
K16679  wengen
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04013  MAPK signaling pathway - fly
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
cqu04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ017286
   04391 Hippo signaling pathway - fly
    CpipJ_CPIJ017286
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ017286
   04215 Apoptosis - multiple species
    CpipJ_CPIJ017286
SSDB
Motif
Pfam: TNFR_c6 CENP-Q DNA_ligase_A_N Trp_oprn_chp
Other DBs
NCBI-ProteinID: EDS45094
VectorBase: CPIJ017286
UniProt: B0XCS7
LinkDB
AA seq 723 aa
MAAVSDDEVATAAILDARPNTSRPAVMHSSHSNSTSSVSLLGLASRRLRWVVAAVTLCTV
LSRVDAVCEPDRWWNPERSECVPCRVCDEQQLVMRPCQEYMDTVCGTMKDLDMDLAQLAR
PEESGADQQRHWKETRKDAAHHRFHNGRDQRHQQQQQHPQGPSRPENTADIMWDWQAASL
LLAIIGCLLFFFAAAIIALNQTRQWKRIEKHFDADMEALSAQLMNHLSSMQQLENGSIFL
DDVIGPERFRSGGGGGGSTSSTSGLLGNSGVHHHHHHHPIEVRCVYLDQLLAQSRSSLYD
PRPRCLSCSEQKRGLGQVLAIRSHKSSVGTRLQTTRDISVRRVRKKLASQHGIIRQQQNK
QLLIVDERLFLLFRYVRGLQRRQETQTGGFLHRRTCSRDASRRSGIVSFSEEETPGKPAQ
RKCVCGESGRLQEQQDGVQYGTKGYHPLENAFWRKSETVTCLARTFQIIEKTSERLRMIK
ILANYFWSVILSPDDLLARRQAGHCGALVDDAIKQSTGRSLAQILMDAQTTADQSKSSHR
MMFRPAPLSVKDVFGKLRKINKMTGTDDGQDLVDVCGGLTRFASVEKLPKLKVEDVALVL
KTIVPLLLVDKCSMMPGTPLRPVLAHPPKGVQKVLERFDGIDLSASGSTTEIGRLSTCWR
TAALTSTVGTRRTTRAYGKGCTKQQGPGNLYIEEHQGGGAAPPGNNGPSAGSATTLTTAG
RMY
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcagctgtcagcgacgacgaagtcgccaccgccgccatcttggatgcgcgacccaac
actagtcgaccggcggtcatgcacagtagtcatagcaatagcactagttccgtaagccta
ctaggattagcgagccgccggctgcgatgggtagtggccgcggtgaccctgtgcacagta
ttgtcccgggtagacgccgtttgcgagccggaccgctggtggaacccggagcggtccgag
tgcgtgccctgccgggtgtgcgacgagcagcagctggtgatgcgaccctgccaggagtac
atggacaccgtgtgcggcaccatgaaggacctggacatggatttggcgcagttggcgcga
ccagaggagagcggagcggaccagcagcggcactggaaggagacgcggaaagacgccgcc
catcatcgcttccacaatggccgcgaccagaggcaccagcagcagcagcagcaccctcag
ggcccgtccaggccggagaacaccgccgacatcatgtgggactggcaggcggcgtccctg
ctgctggccatcatcggctgtctgttgttcttcttcgcggcggccatcatcgcgctcaac
caaacgcgccagtggaagcgcatcgagaagcactttgacgccgacatggaagcgctgtcg
gcgcagctgatgaaccatctgtccagcatgcagcagctcgagaacgggtccatctttctg
gacgacgtgatcggaccggagcggtttcgttccggcggcggtggaggtggttccaccagc
agcaccagtggcctgcttggcaacagtggcgtgcatcaccatcaccaccaccacccgatc
gaggtgcgttgcgtctacttggatcagctgttagctcaatctagatcatcgctctatgat
ccgaggccgcgatgtctctcttgttccgagcaaaaacgaggtcttggccaggtgctcgcc
atcagaagtcacaaaagttccgtcgggacgcggctgcaaacgacaagggacatttccgtt
cgccgggtgagaaagaagttagcatctcagcacggtatcatccgacagcagcagaacaag
cagctgttgattgtggatgagcgtttgtttttgttatttcgatacgtccgcggtctgcag
cgccggcaagaaacccaaactggaggcttcctccaccgacgaacctgcagccgggacgca
agtcgacgaagtggaattgtgtcgttcagtgaggaggaaacaccgggaaagccagcgcaa
agaaaatgcgtttgcggcgagtccggccgcctccaagaacaacaggacggagtacaatac
gggacaaagggttaccacccgctggagaatgcgttttggcggaagagcgaaacggtgacg
tgcttggcgcggacgttccagatcatcgagaagactagcgagcggctgcggatgatcaag
attctggccaactacttctggtcggtgattctgagtccggacgatctgctggcgaggcgt
caagctggacattgcggagcactcgttgatgatgcgattaagcagagcacgggccgaagt
ttggcgcaaatcttgatggacgcacagacgacggcggatcagagcaagagtagccatcgg
atgatgttccggccggcgccgctttcggtcaaggacgtgtttggaaagttgaggaagatt
aacaagatgactggcacggatgatggacaagatttagtcgatgtttgtggcgggttgaca
cggttcgcaagtgtagaaaagcttccgaagttgaaggtggaggatgttgcgttggtgctg
aagacgattgtaccattgctgctggtggacaagtgttcgatgatgccgggaacaccgttg
aggcccgtattggcgcatccgcccaagggcgttcagaaagtgttggagcgattcgacggg
attgatttaagtgcgagtggaagtacgacggagatcggacgcttatccacctgctggaga
acggcagcgttaacatctacagtcggaactaggagaacaacacgagcatatggcaaaggc
tgcactaagcagcagggccccggcaacctgtacatcgaggagcaccaggggggaggagca
gccccgcccgggaacaatggcccgtcggccggaagtgcaaccacgctgacgacggccggc
cgaatgtactaa

DBGET integrated database retrieval system