KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018570Help
Entry
CpipJ_CPIJ018570  CDS       T01079                                 

Definition
(RefSeq) alpha-amylase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00052  Galactose metabolism
cqu00500  Starch and sucrose metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CpipJ_CPIJ018570
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ018570
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CpipJ_CPIJ018570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6052477
NCBI-ProteinID: XP_001868742
VectorBase: CPIJ018570
UniProt: B0XGH0
LinkDB All DBs
AA seq 600 aa AA seqDB search
MLTIYLTLTSLLLVAAIRLKSEQPTKDWWERAGFYQVYPRSFKDSDGDGIGDLNGITEKL
SYLKGIGMRGFWLSPMYKSPMADFGYDISDFRDIQDEYGTMDDFRSQIAEAKRLGLKVIL
DYVPNHSSDKHEWFIKSVNREPGYEDYYVWRDGKPNPDGSEKPLAPNNWLSGMRGSAWEW
NEQRQQYYYHLFTAQQPDLNFRNPTVVQEMKDVLSFWLDVGVDGFRIDSVGCMFEVPADE
NGDFPDEPLSGTTEDQEDFAYLNHIHTIDRPENVEMVYEWRQLLEDYRKEHGGDTRILMT
ESWSGLDIIKPYFRNIRGVEGAQMPFNFRLITELTADSSAYDFKNVIDSWMAIVDDQHSA
NWVLGNHDRGRVATRLGIERADGIAMIELTLPGVSVTYQGEEIAMIDVDISWEQTVDPLG
CNEGRENYAAKSRDPVRTPFQWDDSNLAGFTNGSTTWLPVGPNYKTTNVKVQEADPKSHL
NVFKSLMVLRDSDTFLYGDWSTIAANEQVFIIVRDLKSSDAYLTVVNLGSSVQTLNLNNL
VKDLPKVLYYRVVSGGSAHTIGNPVQASAVTLQAYEAFVLRAKRSEDRKMRGEICERWLS
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgatctacctcaccctaacatcgctcctactcgtcgcggcgatccggctaaaa
tccgaacaaccaaccaaggattggtgggaacgggccggattctaccaggtctacccgcgt
tccttcaaggacagcgatggcgacggaatcggcgacctgaacggaatcaccgagaagctg
tcctacctcaagggcatcggaatgcgtggcttttggctgtcgcccatgtacaagagtccg
atggccgattttggctacgacatctcggactttcgggacatccaggacgagtacggcacg
atggacgactttaggagccagattgccgaggcgaagcggttagggctgaaggtgattttg
gactacgttccgaatcactcgagtgataagcacgagtggttcatcaagtcggtgaatcga
gaaccgggctatgaggactattacgtgtggcgggacggaaagccgaatccggatgggtcg
gaaaagccactggcgccgaataattggctttccggaatgcgtggcagcgcctgggagtgg
aacgagcaacgtcaacagtattactaccaccttttcacggcccaacaaccggacctgaac
ttccgcaacccaacggtggtgcaagaaatgaaggacgtgttgagcttctggctggacgtc
ggcgtcgacggcttccggatcgactcggtcgggtgcatgttcgaggttccggcggacgag
aatggcgactttccggacgaaccgttgagcgggactaccgaggaccaggaggactttgcc
tatttgaaccatatccatacgattgaccgtccggagaacgtggagatggtttacgagtgg
agacagttgctggaggactatcgaaaggaacacgggggtgatacacggattttgatgacc
gagtcgtggtcgggactggacattatcaagccttacttccggaacatccggggagttgag
ggcgcccaaatgccgttcaacttccggttgatcacggaactgaccgcggactcgagtgcg
tacgattttaagaatgtgatcgattcctggatggccatcgtggacgaccagcattcggcc
aactgggtcctcgggaatcacgaccgtggccgggttgcaacccggctgggcatcgaacgg
gccgatggcatagccatgatcgagctgaccctgccgggagttagcgtaacgtaccagggt
gaagagatcgccatgatcgacgtggacatttcgtgggagcaaaccgtcgatccgcttggg
tgcaacgagggcagggaaaactacgcggccaaatcgcgcgatccggtgcggactccgttc
cagtgggacgatagcaacttggcgggatttaccaacgggtcgaccacgtggcttccggtt
ggaccgaactataaaaccacgaacgtcaaggttcaggaagcggacccgaagagtcatttg
aacgtgttcaagtcgctgatggtgcttcgagacagcgatacatttttgtacggcgattgg
agcacgatcgcggctaacgagcaggtttttattattgtacgcgatttgaagagttcggac
gcctacctcaccgttgtgaacctgggaagttccgtccaaacattgaatttaaacaatctt
gtgaaggatttgccaaaagtgctgtactacagagtggttagtggtggttcagcgcataca
atcgggaacccagtccaagcgagtgcggttactctgcaggcttacgaagccttcgttcta
cgtgcgaaacgctcggaggatcgcaagatgaggggcgaaatctgcgagaggtggctttcg
tga

DBGET integrated database retrieval system