KEGG   Chlamydia trachomatis A2497: CTO_0316Help
Entry
CTO_0316          CDS       T02094                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cra  Chlamydia trachomatis A2497
Brite
Enzymes [BR:cra01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTO_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEP35133
UniProt: G4NMD9
LinkDB All DBs
Position
complement(329556..330212)
Genome map
AA seq 218 aa AA seqDB search
MARIVTLFFRMAMVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKS
LDVANATQDLARLIAINPALRFNGGSHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFW
GSFDNFLKNFITSSAAVQGSGWGWLAFCPQKQELMVQTTANQDPLEATTGMIPLLGVDVW
EHAYYLQYKNARMDYLKNFPSIINWDYIENRFVEMSKQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaggatagtaaccttattttttaggatggctatggtcttttcttcttatatgctt
cccgcattgccttatgattacgatgctttagagcctgtaattagtgctgagattatgcaa
ctgcatcatcaaaagcatcaccaaggatatataaataatttgaatgaggccttaaaaagt
ttagatgtagcaaacgctactcaagatttagcaaggttaatcgcaatcaatcctgctctg
cgtttcaatggtggaagccatattaaccactctcttttctgggagatgcttgcgcctcaa
gggaaaggagggggagttcctcctcgtcatgaattgttaaaattaatcgaaaaattctgg
ggctctttcgataactttttaaaaaattttattacttcttctgctgcggtgcaaggatct
ggctggggatggttagctttttgtccccaaaaacaagagcttatggtacagactacagca
aaccaggatcctctggaggcgacgactgggatgatccctctcctaggagtagatgtgtgg
gagcacgcatattatctccagtataaaaatgcgagaatggactatctaaaaaatttcccc
agcataattaattgggattatatagagaatcgctttgtagaaatgagcaagcaataa

DBGET integrated database retrieval system