KEGG   Capsella rubella: 17877811Help
Entry
17877811          CDS       T02984                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
crb  Capsella rubella
Pathway
crb00020  Citrate cycle (TCA cycle)
crb00190  Oxidative phosphorylation
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    17877811
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17877811
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     17877811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 17877811
NCBI-ProteinID: XP_006282691
UniProt: R0GFS1
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAFGLIGRVVGTKPSRLSAAVRLIPARWTSTGSEAQSKASSGGGGANLKTFQIYRWNPDN
PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA
CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS
KKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEA
INDEFKLYRCHTILNCARACPKGLNPGKQITHIKQLQQSG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcggtttgatcggaagagttgttggaaccaaaccgtcaaggttatcagcggcg
gtgcgattgattccggcgagatggacatcaacaggttcagaagcgcaatcgaaagcttca
tctggcggcggaggagctaatctgaagacgtttcagatctatcgatggaatccagataat
cctgggaagcctgagcttcaagattacaaaatcgatctcaaggattgtggtccgatggtt
ctagatgctttgattaagattaagaacgagatggatccgtcgctcactttccgtcgctct
tgccgtgaaggtatttgtggttcgtgtgctatgaacatcgatggatgtaatggtctcgct
tgtttgacgaagattgaatctggatctaaagagactacgattacgccattgccgcatatg
tttgtgattaaggatttggttgtggatatgacgaatttttataatcagtataagagtatt
gagccgtggttgaagaggaagaatccagcatctgttcctgggaaggagattctacagagt
aagaaggatagagctaagcttgatggcatgtatgaatgtattctctgtgcttgctgtagt
acctcttgtcctagctattggtggaaccctgagtcttatcttggccctgctgctttgctc
cacgccaacaggtggataagcgatagccgagatgagtacactaaggaaaggctcgaagca
attaacgatgagttcaagctgtatcgatgccacacaatcttgaactgtgctcgtgcctgt
ccaaagggattaaacccaggaaaacagatcacacacatcaagcagcttcagcaatctggt
tga

DBGET integrated database retrieval system