KEGG   Capsella rubella: 17881156Help
Entry
17881156          CDS       T02984                                 

Definition
(RefSeq) aspartate aminotransferase 3, chloroplastic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
crb  Capsella rubella
Pathway
crb00220  Arginine biosynthesis
crb00250  Alanine, aspartate and glutamate metabolism
crb00270  Cysteine and methionine metabolism
crb00330  Arginine and proline metabolism
crb00350  Tyrosine metabolism
crb00360  Phenylalanine metabolism
crb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
crb00710  Carbon fixation in photosynthetic organisms
crb00950  Isoquinoline alkaloid biosynthesis
crb00960  Tropane, piperidine and pyridine alkaloid biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
crb_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    17881156
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    17881156
   00270 Cysteine and methionine metabolism
    17881156
   00220 Arginine biosynthesis
    17881156
   00330 Arginine and proline metabolism
    17881156
   00350 Tyrosine metabolism
    17881156
   00360 Phenylalanine metabolism
    17881156
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    17881156
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    17881156
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    17881156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17881156
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:crb04131]
    17881156
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crb04147]
    17881156
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     17881156
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class I
   17881156
Membrane trafficking [BR:crb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    17881156
Exosome [BR:crb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   17881156
  Exosomal proteins of other body fluids (saliva and urine)
   17881156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 17881156
NCBI-ProteinID: XP_006289742
UniProt: R0HC80
LinkDB All DBs
Position
Unknown
AA seq 452 aa AA seqDB search
MTTEFSSSSSSSSPSDRRIGALLRHLTAGSDSDNLSSVYASPTSGATGGSVFAHLVQAPE
DPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLINDRTRIKEYLPIV
GLVEFNKLSAKLILGADSPAIRENRVTTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPT
WGNHPKIFTLAGLTVKTYRYYDPSTRGLNFQGLLEDLGAAPPGSIVLLHACAHNPTGVDP
TIQQWEQIRQLMRSKGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNM
GLYGERVGALSIVCKSSDVAGRVESQLKLVIRPMYSSPPIHGASIVAVILRDRNLFNEWT
LELKAMADRIISMRKQLFEALRTRGTPGDWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIY
MTSDGRISMAGLSSKTVPHLADAIHAVATKTV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgagttctcttcttcttcttcttcttcttcaccaagcgatcgtaggatcggt
gctctgctccgtcatctcactgccggttcggattccgataacctgagctccgtttatgcc
tcgccgacatcgggagccaccggcggttctgttttcgctcatcttgttcaagctcccgag
gatcctattcttggggtgacagttgcgtataacaaagatcccagcccagttaagctgaat
ttgggagttggtgcttaccgtactgaggagggaaaacctttggttcttaatgttgtgagg
aaagctgagcagcagcttatcaatgacagaacaagaatcaaggagtatcttcccattgtt
ggattggttgagtttaacaagttaagcgctaagctcatattaggcgctgacagtcctgct
attcgggagaatcgggttacaaccgttgagtgtttgtctggtactggttccctgagagtt
ggaggggagtttttggccaagcattatcatcagaaaacaatttatattactcagccaaca
tggggaaatcatcccaaaattttcaccctggccggtttgacagtgaaaacttaccgctac
tacgatccatcgacacgtgggttgaactttcaaggtttattagaagaccttggtgccgcc
ccacctggttctatagtgcttctccatgcctgtgcccataacccaactggagttgatcca
accattcaacaatgggagcaaatcaggcagttgatgcgatcaaagggattgatgccattc
tttgatagtgcttatcagggctttgcgagtggaagtctggatacagatgcaaaaccgatt
aggatgtttgttgctgatggcggagaatgcctcgttgctcaaagttatgcgaagaacatg
ggactatatggggaaagagttggagctctcagcattgtatgcaaatcatcagatgttgca
gggagagttgaaagccaactgaaactagtgataaggccaatgtactcaagtcctccgatt
catggtgcatcaatcgttgctgtaattctccgagataggaatttgttcaacgaatggact
ctggagctgaaggccatggctgatcgtatcatcagcatgagaaaacagctttttgaggca
ttacgtactagaggtacgcctggagactggagtcacataataaagcagataggtatgttt
acattcacagggttaaacccagctcaagtctcctacatgactaaagagtaccacatctac
atgacatccgacgggaggataagcatggctggtctgagttcgaagactgtaccgcacctt
gcagatgctatccatgctgttgcgaccaaaaccgtctga

DBGET integrated database retrieval system