KEGG   Capsella rubella: 17881244Help
Entry
17881244          CDS       T02984                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
crb  Capsella rubella
Pathway
crb00052  Galactose metabolism
crb00500  Starch and sucrose metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    17881244
   00500 Starch and sucrose metabolism
    17881244
Enzymes [BR:crb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     17881244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 17881244
NCBI-ProteinID: XP_006289249
UniProt: R0FIE6
LinkDB All DBs
Position
Unknown
AA seq 909 aa AA seqDB search
MSSLHWFTNIVFVVVVFCSTSLASPLHGSSQVVLEEETTVVGYGYVVRSVAVDSNEKLLT
ANLDLIKPSSVYAPDVKSLSLHASLETSERLRIRITDFSQQRWEIPENVIPRAGNHSPRR
FVTEEVDGGNSPDSNFLTDPSSDLVFTLHNTTPFGFSVTRRSSGDILFDTSPDQSDPSTY
FIFKDQFLQLSSALPENRSNLYGLGEQTKRSFRLIPGDTMTMWNADIGSENPDVNLYGSH
PFYMDVRGSNGHDEAGTTHGVLLLNSNGMDVKYEGHRITYSVIGGVIDLYVFAGPSPEMV
MNQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLESVVDGYAKARIPLEVMWTDIDYMDG
YKDFTLDPVNFPEDKMKSFVDTLHKSGQKYVLILDPGIGVNRSYGTYNRGMEADVFIKRD
GEPYLGEVWPGKVYFPDFLNPAAATFWSNEIKIFQDILPLDGLWIDMNELSNFITSPLTP
GSSLDDPPYKINNFGDNAPINNKTVPATAIHFGNVSEYNAHNLYGLLEAKATHQAIVDVM
GKRPFVLSRSTFVSSGKYTAHWTGDNAAKWEDLAYSIPGILNFGLFGIPMVGADICGFSH
DTTEELCRRWIQLGAFYPFARDHSSLNTARQELYLWESVASSARKVLGLRMRLLPHLYTL
MYEAHVSGIPIVRPLFFSFPQDTNTYEIDSQFLIGKSIMVSPALEQGKLTVDAYFPAGNW
FDLFNYSFAVGGASGKHVRLDTPADHVNVHVREGSIVAMQGEAMTTRDARKTPYELLVVA
SRLENISGELFLDDGEKIQMGEGGGNRDWTLVKFRCYVTGKSVVLRSEVVNPEYASRMKW
SIGKVTFVGFENVESVKTYEVRTGERLRSPRISLIKTVMDDDDPRFLSVEVSKLSLLVGK
KFEMRLKLT
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcttcactggtttaccaatatcgtcttcgtcgttgtcgtcttctgctccacg
agtttagcttcacccttacatggaagctcacaggttgtactagaagaagaaaccacagta
gtaggatacggctacgtcgttagatcagtggctgttgattccaatgagaagcttttgacg
gcgaatcttgacctgatcaaaccgtcgtccgtttacgcaccggatgtgaaatcgcttagt
cttcatgccagcttggagacgagtgagcgtttgagaatcagaatcacagattttagtcaa
caaagatgggagataccggaaaatgttattcctcgcgccggaaaccactctcctcgccgt
ttcgtaacggaggaagtagacggaggaaactcgccggacagcaatttcttaacagatcca
tcatcggacttagttttcacactccacaacaccacgcctttcggtttctccgtcacccga
cgctcctccggcgatatcctcttcgacacttcgccggatcaatcagatccgagcacttac
ttcatcttcaaagaccaattccttcaactatcttccgcgttaccggaaaacagatcgaat
ctgtatggtctcggggagcaaaccaagcgatcgttcaggctaatcccgggtgatactatg
actatgtggaacgccgacatcggtagcgagaatccggatgttaacctttacggatcgcac
ccgttttacatggatgtaagaggatcaaacggtcatgacgaagcagggacgactcacggc
gttttgttgctgaacagcaatggaatggatgtgaagtatgaaggacatcggattacttac
agtgtgatcggaggagtcattgatctctatgtgttcgctggaccatcacctgaaatggtg
atgaatcagtacacagagcttattggaagacctgctcctatgccttactggtcatttgga
tttcaccaatgtaggtatggctacaagaatgtttcagacctcgaatctgtagttgatgga
tatgcaaaagctagaatacctcttgaggttatgtggacagacattgattacatggacggc
tacaaagacttcactttggaccccgtaaatttcccagaggacaagatgaaatcatttgtg
gatacacttcataagagtggtcagaaatacgtgctgatcttggatcccggtattggtgtg
aacagatcttacgggacttataatagagggatggaagcagatgttttcataaagcgagat
ggtgagccttatctcggtgaggtttggcccggaaaagtatacttccctgacttcttgaat
ccagctgctgcaactttctggagcaatgaaatcaagattttccaggacattctccctttg
gatggtctgtggattgacatgaatgagttatcaaatttcataacttcacctctaacccct
ggatcttcactcgatgatcctccttacaagattaacaattttggggacaacgcgccaata
aacaacaagacagttcccgcaacagctatccattttggaaacgttagtgaatacaatgcg
cataacttgtatggcctgttggaagctaaagccactcaccaggctatagtggatgtaatg
ggaaagagaccatttgttttgtcgagatccacgtttgtaagctccggaaagtacacggct
cactggactggtgataatgctgcaaaatgggaggatttggcttactcaatccctggaatt
ctcaactttggtctgtttgggattcctatggttggagctgatatatgtggtttctcacat
gataccaccgaggaactatgtcgtcgatggatccagcttggagctttttacccttttgca
agagaccattcgtcccttaataccgccagacaagaattatacctctgggagtctgttgct
tcttctgcaagaaaggttctcggcctccgtatgagactgctcccacatctctatacactg
atgtatgaggctcacgttagcggcatcccgatcgtgagaccactcttcttctcgttccct
caagacactaacacttacgaaattgattcacagttcttgatcggtaaaagcataatggtt
tctccggcgctggagcaaggaaagctgacggtagatgcatatttccctgccggaaactgg
tttgatctttttaactattcatttgccgtcggtggagcttctggcaagcacgttaggctt
gacactcccgcagatcacgtgaacgttcatgttcgagaaggtagtattgtggctatgcaa
ggagaggcaatgacaactagagacgccagaaagacaccgtatgagcttctagttgtagcc
agccggcttgagaacatatccggcgaactgtttctggatgacggggaaaagatacagatg
ggagagggaggaggaaaccgtgattggactctcgtgaagttccggtgctacgtaacaggg
aaatcggtggtactgagatcagaagtggtgaacccagagtacgcttcgagaatgaaatgg
agcatagggaaagtgacatttgttgggttcgagaacgtagagagcgtgaaaacgtacgag
gtgaggacaggtgagagattgagaagtccgagaatctcgctaatcaaaacggttatggac
gatgatgatccgaggtttctcagtgtggaggtttcaaagctgtcgttgcttgttgggaag
aagttcgagatgagattgaaattgacttga

DBGET integrated database retrieval system