KEGG   Capsella rubella: 17883890Help
Entry
17883890          CDS       T02984                                 

Definition
(RefSeq) DNA polymerase epsilon subunit B
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
crb  Capsella rubella
Pathway
crb03030  DNA replication
crb03410  Base excision repair
crb03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17883890
   03410 Base excision repair
    17883890
   03420 Nucleotide excision repair
    17883890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:crb03032]
    17883890
   03400 DNA repair and recombination proteins [BR:crb03400]
    17883890
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     17883890
DNA replication proteins [BR:crb03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    17883890
DNA repair and recombination proteins [BR:crb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      17883890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B DUF4854 DNA_pol_D_N
Motif
Other DBs
NCBI-GeneID: 17883890
NCBI-ProteinID: XP_023637189
LinkDB All DBs
Position
Unknown
AA seq 525 aa AA seqDB search
MSSTSQRKKIQKKFKNRGYNLKFDALDEILVFADQFPDDADGEAIDLLLDNLQESHESST
VDAESVRELINRLLGAHNAPEEPTTSASSLAVIDAFLVPKFGYDAVKKKFNEHTKSLPIH
GEAYAKTALYRERFMLLSQRVSRAEHFSRPAFDAEMSQFESNEISSIQSLISQRGRKWVM
GVISQLEDGHFYLEDLSASVEIDLSKAKITTGFFTENTIILAEGEMQVNGIFQVITCGFP
PLEDRDKTLKTHSECDFFGGGTQTKEETIRLADLERQAVNDTFVILSDIWLDNEEVIGKL
ETVLDGFENVETVPSLFVFMGNFCSRPCNLAFGSYSSLREQFGKLGRMIGNHPRLKESSR
FLFIPGPDDAGPSTVLPRCALPNYLTEELQNIIPNAIFSSNPCRVKFYNQEIVFFRQDLL
YRMRRSCLVTPSSEETKDPFKHLVYTITHQSHLCPLPLMVQPIIWNYDHSLRLYPTPHTI
VLGDKSEQEVCKFGGTTCFNPGCFSTDSTFVAYRPSTQEVELSAL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacgagtcagaggaagaagatacagaagaaattcaaaaatagaggatacaac
ctcaaattcgatgccttagacgagattctcgttttcgccgatcaatttcccgacgacgct
gacggagaagctatagatcttctcctcgataacctccaggaatcgcatgaatcttccact
gttgacgccgaatcagttcgagaattgattaatcgcttgctgggagctcataacgcgccg
gaagaacctacaactagtgcttcttccttggccgtcatcgacgcgtttctggtgccaaaa
tttggatatgatgctgttaaaaaaaagtttaacgagcatacgaagagcctgcctattcat
ggtgaggcttatgcaaaaacagctttatacagggaacgattcatgttgctgtcgcagaga
gtttctcgcgctgagcatttttctaggccagcatttgatgctgaaatgtcacaatttgag
agcaatgagatatcttcaatccagtcactaatttctcaaagaggaaggaaatgggtgatg
ggcgtgatatcccagttggaagatggacatttctacctagaagacctttcagcttctgta
gagattgatctgtccaaagcaaagataacaacaggattcttcacagagaatactataatt
ttggcagaaggcgaaatgcaggtgaacggtatctttcaggtgattacatgtggatttcct
cccttagaagacagggacaaaacactaaagacacattctgaatgcgacttctttggaggc
ggcacacaaactaaagaagagacgattagacttgcagaccttgaaagacaagctgtgaat
gacacatttgtcatattgtctgacatatggttggacaacgaagaggttatcggaaagctg
gaaactgttcttgacggttttgaaaatgtggagacagtaccctccttgtttgtttttatg
ggaaatttttgttctcgcccatgcaacttagcctttggttcttattcaagccttagggag
cagtttggtaaacttgggaggatgattggaaaccatccacggctaaaagaaagcagtcga
tttttattcattcccggtcctgatgacgcaggtccctcgactgtcttgccaagatgcgct
ttaccgaactatttaaccgaagagcttcagaacattattcccaatgcaatattttcaagc
aatccttgcagagtaaagttttataaccaagagattgtgttcttccgacaagatcttctg
tataggatgcgtcgttcatgcttagtaaccccttcctcagaagaaactaaggaccctttt
aagcatcttgtctatacaataactcatcagagccatctgtgtcctctacctctcatggtg
caacccatcatttggaactatgatcactctcttcgactgtacccaactcctcatacgata
gtattaggtgacaagagtgagcaagaggtatgcaaatttgggggaacaacatgcttcaat
ccaggctgcttttcaactgatagcaccttcgtagcttatcgaccttccactcaagaagtc
gaactctctgctttgtga

DBGET integrated database retrieval system