KEGG   Capsella rubella: 17885786Help
Entry
17885786          CDS       T02984                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
crb  Capsella rubella
Pathway
crb00010  Glycolysis / Gluconeogenesis
crb00020  Citrate cycle (TCA cycle)
crb00620  Pyruvate metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
Module
crb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    17885786
   00020 Citrate cycle (TCA cycle)
    17885786
   00620 Pyruvate metabolism
    17885786
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     17885786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Pyridox_oxase_2
Motif
Other DBs
NCBI-GeneID: 17885786
NCBI-ProteinID: XP_006291003
UniProt: R0FP98
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MAVSSSSFLSTASLTNSKSNISFASSVSPSIRSVVFRSSIPPSSHRRVMTVRSKIREIFM
PALSSTMTEGKIVSWIKTEGEKLAKGESVVVVESDKADMDVETFYDGYLAAIVVGEGETA
PVGAAIGLLAETEAEIEEAKTKAASKSSSSPAAEAVVPSPPPVTSSPAPAIAQPAPVTAV
ADGPRKTVATPYAKKLAKQHKVDIGSIAGTGPFGRITASDVETAAGIAPSKSSVAPPPPP
PPPAAATGKATTATNLPPLLPGSSIVPFTAMQSAVSKNMIESLSVPTFRVGYPVNTDALD
ALYQKLKAKGVSMTALLAKAAGMALAQHPVVNASCKDGKSFSYNSNINIAVAVAINGGLI
TPVLQDADKLDLYLLSQKWKDLVSKARSKQLQPHEYNSGTFTLSNLGMYGVDRFDAILPP
GQGAIMAVGASKPTVVADKDGFFSVKNTMLVNVTADHRIVYGADLASFLQTFAKIVENPD
SLTL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcttcttcttcgtttctatcgacagcttcactcaccaattccaaatccaac
atttcattcgcttcctcagtatccccatccattcgcagcgtcgtattccgctcctcgatt
cctccgtcatcccaccgccgtgtaatgaccgtccgatcgaagattcgagaaattttcatg
ccggcgttgtcatcaaccatgacggaaggcaaaatcgtgtcgtggatcaaaaccgaaggc
gagaaactcgccaagggagagagtgttgttgtcgttgaatctgataaagccgatatggat
gtcgaaacgttttacgacggttatctcgccgcaatcgtcgtcggagaaggtgaaacggct
cccgttggtgctgcgattggattgttagctgagactgaagctgagattgaagaagcaaag
actaaagctgcttcgaaatcttcttcttctcctgcggctgaggctgttgttccatctcct
cctccggttacttcatctcctgctccggcgatcgctcaaccggctccggtgacagctgta
gcagatggtccgaggaagactgtagcaacgccgtatgctaagaagcttgctaaacagcat
aaggttgatattggatccattgctggaactggaccattcggtaggattacggcttctgat
gtggagacggcggctggaattgctccgtccaaatcctctgtggcaccaccacctcctcct
cctcctcctgcggcggcgactggaaaagctaccacagcgaccaatttgccgcctctattg
cctggttcaagcattgttcctttcacagcaatgcagtctgcagtatcgaagaatatgatt
gagagtctctctgttcctacattccgtgttggttatcctgtgaacactgatgctctcgat
gcactctaccagaagctgaaagcaaagggtgtatcaatgacagctttattggctaaagct
gcagggatggctctggctcagcaccctgtggtgaatgcaagctgcaaagatgggaagagt
tttagttacaatagtaacattaacattgctgtggcagttgctattaacggtggcttgatt
acgcctgttctacaagatgcagataagttggatttgtacttgttatcccaaaagtggaaa
gacttggtatcgaaagctagaagcaagcaactgcaaccccatgaatacaactctggaact
ttcactttatcgaatcttggtatgtatggagtggatagatttgatgctattcttccgcca
ggacagggtgcaattatggctgttggagcgtcgaagccaactgtagttgctgacaaggat
ggattcttcagtgtgaaaaacacaatgctggtgaatgtgactgcagatcatcgcattgtc
tatggagctgacttggcttcttttctacaaacctttgcaaagatcgttgagaatccagat
agtctgaccttataa

DBGET integrated database retrieval system