KEGG   Capsella rubella: 17886414Help
Entry
17886414          CDS       T02984                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
crb  Capsella rubella
Pathway
crb00250  Alanine, aspartate and glutamate metabolism
crb00410  beta-Alanine metabolism
crb00430  Taurine and hypotaurine metabolism
crb00650  Butanoate metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    17886414
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    17886414
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    17886414
   00430 Taurine and hypotaurine metabolism
    17886414
Enzymes [BR:crb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     17886414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Big_4
Motif
Other DBs
NCBI-GeneID: 17886414
NCBI-ProteinID: XP_006290959
UniProt: R0FN01
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGEGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREDYYVMDPKIAVDMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTP
IHVDAASGGFIAPFLDPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRDNMMVLRQGLEK
TGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAETLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGNVKKTPEEMQREVTSYWKKLLE
TKKTSKNTIC
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagcttctgaatcggatgtctcaatccactcaacttttgcttct
cgttacgtccgcaactctcttccacgatttgagatgcctgagaactcaatcccaaaggaa
gcagcgtaccaaatcatcaacgatgagcttatgctcgacggtaacccgaggctgaaccta
gcttcctttgtgaccacatggatggagccagagtgtgacaagctcatgatggagtccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccactgagcttcagaaccgatgt
gtcaacatgatcgcgcgtctcttcaacgcgccccttggtgaaggtgaagcagccgttggt
gtcggtaccgtgggatcgtcggaggcgattatgttggccggtttggctttcaagagacag
tggcagaataaacgtaaggcccaagggcttccttatgataagcccaacattgtaaccgga
gccaatgtccaggtttgctgggagaaattcgcaaggtacttcgaagtggagcttaaggaa
gtgaagctgagagaagattactacgtgatggaccctaaaattgcggtagacatggtagac
gaaaacacaatctgcgtcgcggccatcctcggttcaacgctaaccggtgaattcgaagac
gtaaagctcctcaacgacctcctcgtcgagaaaaacaagcaaaccggatgggacacgcca
atccacgtggacgcagcgagtggtgggtttatcgcaccgttcttggacccggagctggag
tgggatttcaggctaccgttggttaagagcattaatgtgagtggacacaaatacggtttg
gtttacgccggtattggttgggttgtatggagaaccaaaaccgatttgcctgatgaactt
atcttccatatcaattatcttggcgctgatcaaccaaccttcacactcaacttctccaaa
ggttcaagtcaagtgattgctcagtactaccagctcattcgtcttggattcgagggatat
cgcaatgtgatggaaaattgtcgggacaacatgatggtgctaagacaaggattggagaaa
acgggacgtttcaaaatcgtctccaaagaaaacggtgttccgttggttgcgttttctcta
aaagacagtagccgccacaacgagttcgaggtggctgaaacgctccgccgttttggctgg
atcgttccggcatacacgatgcccgcggatgcgcagcacgtcaccgtgctccgtgttgtg
atccgagaagacttctcccgaaccttggccgagagacttgtggctgatttcgagaaggtt
ctacacgagctcgatacgcttccggcgagggttcacgccaagatggctaacggaaatgtt
aagaagacgccggaggagatgcagagagaagtcacgtcctactggaagaagctgttggag
actaagaagactagcaagaacactatttgctga

DBGET integrated database retrieval system