KEGG   Capsella rubella: 17887410Help
Entry
17887410          CDS       T02984                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
crb  Capsella rubella
Pathway
crb00562  Inositol phosphate metabolism
crb01100  Metabolic pathways
crb04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    17887410
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    17887410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:crb01009]
    17887410
Enzymes [BR:crb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     17887410
    3.1.3.48  protein-tyrosine-phosphatase
     17887410
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     17887410
Protein phosphatases and associated proteins [BR:crb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    17887410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc CDKN3 Y_phosphatase3 Y_phosphatase DUF3246 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 17887410
NCBI-ProteinID: XP_006290734
UniProt: R0FMD8
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MMETDPVDSSSQSPAIVSEKDVTIPGNSETFQEVMGVEEGPVSSVGEAPKDFNRTEASAA
KVDTPMPSTGSEPSSKTEDIVPCPPGSSPRESPPSIFSSSGLSSWAKSLKFPQQDPNTAD
SGMSAFTRFTSELGLHLPTKGSDEASDPKPPNTQVGGALESLTKAVVDSSRGAVKAMQVK
ARHIVSQNKRRYQEGEFDLDMTYITENVIAMGFPAGDISSGLFGFFEGFYRNHMEEVIKF
FETNHKEKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSAYTWLKEDI
QNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVLPSQIRYVK
YYERVQNQFDGKVPAEQRCMLRGFRLINCPYWIRPAITISNHTDILFSTKKHQKTKDLGP
EDFWIKAPKKGVVVFAIPGEAGLTELAGDFKVHFQDSDGDFYCWLNTTLTDNRTMLKGSD
FDGFEKRKLPAPGFHVEIVMIESDNSQPTKSKSDSTQKQSQSSSSAGSSKLKSNQNEDDD
VFSDSDGEEDRHSKPIETNSKTEKTVDSMHTTSKPHQINEPPKIDVHDSSANRSLTSSSS
SGLHNPVPNHSLAVSDIKAIAADASVFSFGDEEEDYESD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaactgatcctgttgactcgtcatctcagtctccagctatagtatctgagaaa
gatgtaaccattcctggtaattctgaaacttttcaagaagttatgggtgttgaagaaggt
cctgtgagctctgtaggagaagctcctaaagattttaataggacagaagcttcagctgca
aaggttgatactccaatgccttctactggctctgaaccttcgagtaaaactgaggatata
gttccatgcccgccaggttcatccccacgcgaatcgccaccatctatattttcttcttct
ggtctttcttcttgggccaaaagtttgaaattcccgcagcaagatccaaacactgcagat
tctgggatgtcagctttcacaagattcacctctgaacttggtctgcatttgccaacgaaa
gggtcagatgaggccagcgaccctaaaccaccaaacacacaagttggtggtgctcttgag
tcgctcacgaaagccgtggtagattcctctcgtggtgctgtaaaagcaatgcaggtgaaa
gcacgccacattgtctcgcagaacaaaagaagataccaggagggggaattcgatttggac
atgacatatataactgagaatgtaatcgcaatggggttcccagctggtgacataagctct
ggtctttttggatttttcgagggattttatcgtaaccacatggaagaggtgatcaagttt
ttcgaaactaatcacaaggaaaaatataaggtctacaacctttgttcagagagattgtat
gatgcttcgagatttgaggggaaggttgcatctttcccatttgatgaccataactgtcct
cctatccaattgataccatcattttgtcaaagtgcatacacatggctgaaggaagatatc
caaaatgtagtggtagttcattgtaaagctggaatggcaagaaccggattaatgatttgc
tgtcttcttctatatctcaagttctttcctacagctgaggaggctattgattactataat
caaaagagatgtcttgatgggaaagctctcgttctcccaagtcagattcgatatgtcaag
tactacgaacgtgttcaaaatcaatttgacgggaaagttccagctgaacaaagatgcatg
ctcagagggtttcgtctaatcaactgcccttactggattagacctgccattacgatctcc
aaccacactgatatacttttctcaacaaagaagcatcagaaaaccaaggatttggggcct
gaagatttttggataaaggcacccaaaaaaggagttgttgtctttgcaatacctggtgaa
gctggtctaacagaattagccggagacttcaaagtccactttcaagatagtgatggagat
ttttactgttggctaaatactacactgactgataacagaacaatgctgaaaggtagtgac
tttgatggcttcgaaaagagaaaactgcctgcaccgggtttccatgtcgagatcgtaatg
atagaatccgacaattctcaaccaacaaagtccaaatctgattccacccaaaaacaatct
caaagcagctccagtgctggatccagcaaactcaagtctaatcagaacgaagacgatgat
gtattctccgacagtgatggggaagaggacagacactcaaaacccattgagaccaattca
aaaaccgagaaaaccgtagactcgatgcacacaactagtaaacctcatcagatcaatgag
ccaccaaagatagatgtccatgactcttccgcaaacagaagtctcacaagttcatcatcc
tccggtcttcataatccagtaccaaaccactcattagcagttagtgatatcaaagctatt
gctgcagacgcatcggtcttctcctttggagatgaggaagaagactatgaaagcgactga

DBGET integrated database retrieval system