KEGG   Capsella rubella: 17890108Help
Entry
17890108          CDS       T02984                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2, chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
crb  Capsella rubella
Pathway
crb04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:crb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    17890108
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     17890108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 17890108
NCBI-ProteinID: XP_006294965
UniProt: R0HUW0
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MAAANTILAFSSPSRLLIPSSSTPSPSSSSSTLRSSFRGVSLNNLHRRPQSVSFSARAPS
KSLTVVSAAKKAVAVLKGNSDVEGVVTLTQDDSGPTTVNVRITGLTPGPHGFHLHEFGDT
TNGCISTGPHFNPNNMTHGAPEDECRHAGDLGNINANADGVAETTIVDNQIPLTGPNSVV
GRAFVVHELKDDLGKGGHELSLTTGNAGGRLACGVIGLTPL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccaacaccatcctcgcattctcatctccttctcgtcttctcattccttct
tcctccactccctctccttcttcttcttcttcgactcttcgttcctctttccgtggcgtc
tctctcaacaaccttcaccgtcgtccccaatccgtttccttctccgccagagctccttcg
aaatcgttgacagttgtttccgccgcgaagaaggctgttgctgttcttaagggtaactcc
gatgtcgaaggagttgttactctgacccaagatgactcaggtcctacaactgtgaatgtt
cgtatcactggtctcactccagggcctcatggatttcaccttcatgagtttggtgataca
acaaatggttgcatctcaacaggaccacatttcaaccctaacaacatgacacacggagct
cctgaagatgagtgccgtcatgcgggtgacctgggaaacataaatgctaacgccgatggc
gtggcagaaacaacaattgtggacaatcagattcctctgactggtcctaactctgttgtt
ggaagagcctttgtggttcacgagcttaaggatgaccttggaaagggtggacatgagctt
agtctgaccacaggaaacgcaggcggaagattggcatgcggagtgattggcttaacgccg
ctctaa

DBGET integrated database retrieval system