KEGG   Capsella rubella: 17890904Help
Entry
17890904          CDS       T02984                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
crb  Capsella rubella
Pathway
crb00071  Fatty acid degradation
crb00592  alpha-Linolenic acid metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01212  Fatty acid metabolism
Module
crb_M00087  beta-Oxidation
crb_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    17890904
   00592 alpha-Linolenic acid metabolism
    17890904
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     17890904
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     17890904
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     17890904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 17890904
NCBI-ProteinID: XP_006297065
UniProt: R0I0V1
LinkDB All DBs
Position
Unknown
AA seq 725 aa AA seqDB search
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGA
KGKFSGGFDISGFGEIQKGTRKEPKVGYISIDIITDLLEAARKPSVAAIDGLALGGGLEL
SMACHARISTPGAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVRAEEGHS
LGLIDAVVPSAELLTTARRWALDIVERRKPWISSLLKTDKLPPLGEAREILKFARGQTRK
QAPNMKHPLMCLDALEMGIVSGPRAGLEKEAEVGSQVISLDTTKGLIHVFFSQRGTAKVP
GVTDGGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ
SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH
CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVERGADPYLIDMAISKFGMPMGPFRLCD
LVGFGVAIATATQFIENFPERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPEL
KKYIEKARSISGGNVDPKLVKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAAIM
GMGFPPYRGGIMFWADSMGSKYIYSRLDEWSKTYGDFFKPCAFLAERASKGAPLSAPVEQ
ARSRL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggattcacgaaccaagggtaagacggtgatggaagttggtggcgatggcgttgccgtc
ataacactcatcaatcctcctgtcaattctctatcttttgacgtgctgtacaacctcaaa
agtaattacgaggaggccttgagcaggaatgatgttaaagctattgttattactggtgca
aagggaaagttctctggtggctttgatatttctggttttggtgaaatccagaaggggact
aggaaagagccaaaggttggatacatatcaatcgacatcatcaccgacttgcttgaagct
gctaggaagccctctgttgctgccattgatgggcttgccttgggaggagggttagaactt
tctatggcttgccatgcaaggatatcaactcctggtgcacagttaggtctgcccgagctg
caactcggtgttattcctggatttggaggaacgcaacgtcttcctcgtcttgttggtctc
acaaaagcccttgaaatgattttgacatctaagccagttagagctgaagaaggtcattca
ttgggccttattgatgctgtagtgccatctgccgagttattaaccactgctcgtcgttgg
gcccttgacatagttgagaggagaaaaccatggatttctagtctcttaaagactgacaag
ttacctcctcttggagaggcaagggagatactgaagtttgccagaggacagacacgcaag
caagcccccaatatgaaacaccccttaatgtgccttgacgctcttgaaatgggtattgtt
tctggtccaagggctggcttagaaaaggaggctgaagtcggctctcaagtgatcagcctt
gataccaccaaaggcttgatccatgtattcttttcccagcgaggaactgcaaaggttcct
ggagttactgatggtgggttggtgcctaggaagattaaaaaggtagccataattggtggc
gggttaatgggatctggaattgccactgcattaatcctaagtaactatccagtgattctc
aaggaggtaaatgagaagttcctggaggcgggaattggcagagttaaagctaatcttcag
agtcgtgtaaggaaaggaagcatgtctaaggaaaagtttgagaaaaccatgtctctcctt
aagggttctcttgattatgagagctttagggatgtggacatggtcattgaggctgttatt
gaaaatatatctttgaagcaacaaatttttgctgatttggagaagtactgtcctcagcat
tgtattctcgctagcaacacatctaccattgacttgaacaaaattggggagcggaccaag
tctcaggatcgaattgttggagcacattttttcagtccagcacacgtcatgccactactt
gaaatagttcggactaatcatacctctgcccaagtaattgttgacctgttagatgttggt
aagaagattaagaaaacaccagtcgtggtgggaaactgcacaggttttgcagtgaatagg
atgttcttcccttacacacaggcagctatgttccttgttgagcgtggagcagatccatat
ctaattgacatggcaatcagcaagtttggaatgccaatgggtcctttcagattgtgtgac
ttggttggatttggtgtggcgattgcaaccgcaacacaattcattgagaacttcccagaa
cggacatacaaatcaatgattatcccacttatgcaagaggacaagagagctggtgaagcg
actcgtaaaggtttctatttgtatgatgataagcgcaaggctaaacctgatcctgagtta
aagaaatatatcgaaaaggcaaggagcatatctggaggaaatgttgaccctaagttggtg
aaactgtcagagaaggaaataattgaaatgacatttttcccagtagtaaacgaggcgtgt
agggtttttgctgaaggtattgcagtcaaagctgcagaccttgacattgctgccataatg
ggaatgggttttccaccttacagaggaggaatcatgttctgggctgattccatgggatcg
aaatacatttactcgaggctagatgagtggtcaaagacttacggtgatttcttcaagcct
tgtgcttttttggctgaaagggcatctaaaggagctcctctgagcgctcccgtggagcaa
gccagatcgcggttgtaa

DBGET integrated database retrieval system