KEGG   Capsella rubella: 17890947Help
Entry
17890947          CDS       T02984                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
crb  Capsella rubella
Pathway
crb00020  Citrate cycle (TCA cycle)
crb00190  Oxidative phosphorylation
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    17890947
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17890947
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     17890947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 17890947
NCBI-ProteinID: XP_023642156
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MWRCLRVAARRSESKGGFINSQLSRFFSAPSTGDGTSYRIVDHTYDAVVVGAGGAGLRAA
IXVSEHGFNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLYTLYGQAMKHNTQFFVEYFALDLIMNNDGTCQGVIALNMEDGTLHRFHAGSTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGARGEGG
ILRNSEGEKFMDRYAPTARDLASRDVVSRSMTMEIREGRGAGPMKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTREPIPVLPTVHYNMGGIPTNYHGEVVTVRGDDPDAIVPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEKLKPLEKDAGAKSIEW
LDRIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCDLIDRTWDSFGDVKVTDRS
LIWNSDLIETMELENLLINASITMHSAEARKESRGAHAREDFTKRDDANWMKHTLGYWEE
GNVKLEYRPVHMNTLDDEVDTFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgccttcgagttgcggcgaggagatcggaatctaaaggcggtttcatcaat
tctcaactctccagattcttctcagctccttcgacaggggatggaacatcgtatagaatc
gttgatcatacgtacgatgcggttgttgtaggagctggtggtgctgggcttagagcagcc
atatgagtatcagaacatggttttaacacagcttgtatcactaagctttttccaactcgt
tctcatacagttgcagctcagggaggtgttaatgctgcattgggtaatatgactgaagat
gattggagatggcatatgtatgatactgttaaaggaagtgattggttaggtgatcaagat
gcaattcagtatatgtgcagggaagctccaaaagctgtgattgaacttgagaattatgga
ttgccattttctagaacagaagatgggaaaatatatcaacgagctttcggtggccagagt
cttgattttggaaaaggtggccaagcatatcgttgcgcatgtgctgctgaccgcactggg
catgctctgttgtatactctttatggccaagcaatgaaacacaacactcaattctttgtg
gagtactttgccttggatttaataatgaacaatgatggaacatgtcaaggagtcattgca
ctgaacatggaagatggaacattacatcgtttccatgctggttctacaattttggctacc
gggggctatggaagagcttatttctctgcaacttcagcacatacatgtacaggagatggc
aatgctatggttgcacgggccgggctaccgctgcaggacttggagtttgttcagtttcac
cctactggtatatatggagccggatgtctaatcacagaaggagctcgaggtgaaggtggg
attctcagaaacagtgaaggtgagaaattcatggaccgatatgctcctacagctagagac
cttgcttcaagagatgttgtttcaagatcaatgactatggaaatcagagaaggacgtggt
gcaggacctatgaaggatcatatataccttcacctaaatcatctaccaccagaggtgctt
aaagagaggcttcctggcatatctgagactgcggctattttcgcgggtgtagatgttaca
agagagccaattcctgtattgcctactgtgcattataatatgggtggtattcccacaaac
taccatggagaggttgttacagttagaggtgatgatccagatgctatagttcctggacta
atggctgcaggagaagcagcgtgtgcatcggttcatggcgctaatagacttggcgcaaat
tcacttcttgacattgttgtttttgggagagcttgtgcaaacagagttgcagagattcaa
aaacctggcgagaaactgaaacctctagagaaggatgcgggtgcgaagagtatcgaatgg
ttggaccggataagaaactctaatggttcgcttccaacttctaaaatacgcttaaacatg
caaagagtaatgcaaaacaatgctgctgtcttccgtacacaagaaacactagaagaaggt
tgtgatttgatcgataggacatgggacagttttggtgatgtcaaagtgacagatcggagt
ttgatatggaactcggatttgatagaaactatggagttggagaatcttttgattaatgca
agcataactatgcattctgctgaggctaggaaggagagtcgaggagcacatgcgcgtgag
gatttcacgaaacgagacgatgcaaattggatgaagcacacattggggtattgggaagaa
gggaatgtgaaattggagtatagaccagtgcacatgaatacattggatgatgaagttgac
acttttcctcctaaagctcgtgtttattga

DBGET integrated database retrieval system